[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49715.1


[Show Plain Result]

## Summary of Sequence Search
   1::621
 344::414  PF00015 0.0% 19.7183098591549  Methyl-accepting chemotaxis protein (MCP) signaling 
 428::618  PF00015 0.0% 42.4083769633508  Methyl-accepting chemotaxis protein (MCP) signaling 
 150::223  PF02743 0.0% 47.9452054794521  Cache domain 
  22::37   PF00672 0.0% 12.5  HAMP domain 
 287::354  PF00672 0.0% 29.4117647058824  HAMP domain 
 400::434  PF00672 0.0% 31.25  HAMP domain 
 342::416  PF07889 0.0% 13.3333333333333  Protein of unknown function (DUF1664) 
 439::461  PF07889 0.0% 8.69565217391304  Protein of unknown function (DUF1664) 
 500::570  PF07889 0.0% 16.9014084507042  Protein of unknown function (DUF1664) 
 554::617  PF07889 0.0% 22.9508196721311  Protein of unknown function (DUF1664) 
   1::621


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSMVPSSRIKPSGSLKFQVSVFIAILLIVCVMAVSWLSISKMEKAINQKVKEGEMVASLIIREEIQHFLD
PF00015         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF02743         ----------------------------------------------------------------------
PF00672         ---------------------vlllalllalvlawll---------------------------------
PF00672         ---------------------vlllalllalvlawll---------------------------------
PF00672         ---------------------vlllalllalvlawll---------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SKGEIVKNLSLAQEFQSQDKKQILKLLLSAQNQSEFQNIYFVTGSGEITIAPVKQLPKDFDPRQRVWYQE
PF00015         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF02743         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AVKKGTMVCTDPYIDQATGKPCMTVALAVKDSEGRFVGVLGADIKLETISSLAVKYKFGEEGYFYVCDKQ
PF00015         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF02743         ---------TepYidaatgklvitvalpvfd.kgallGVvglDvsledllkltkkiklgknGyafiidnn
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GKVIGHPDAKAINGDIMNRAYVKAALAGKSGFDTYADNGVKKLVYYSEIPKTGWGLFVQQPEQEAYAELY
PF00015         ----------------------------------------------------------------------
PF00015         ----------------------------------------------------------------------
PF02743         gkvlahpnlkpvt---------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------
PF07889         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RARNMIIIITLLILASALVISLYFTGKMVNVIKMVGEGARAIAQGNLTYSLTIARKDELGILSDSINEMT
PF00015         ---------------------------------------------------------------keIveav
PF00015         ---------------------------------------------------------------keIveav
PF02743         ----------------------------------------------------------------------
PF00672         ------lvvlllalllalvlawllarrilrPlrrLaeaarriaeGdlddrvpvdgrdEigeLarafnaml
PF00672         ------lvvlllalllalvlawllarrilrPlrrLaeaarriaeGdlddrvpvdgrdEigeLarafnaml
PF00672         ------lvvlllalllalvlawllarrilrPlrrLaeaarriaeGdlddrvpvdgrdEigeLarafnaml
PF07889         -------------------------------------------------------------lsdAvasvt
PF07889         -------------------------------------------------------------lsdAvasvt
PF07889         -------------------------------------------------------------lsdAvasvt
PF07889         -------------------------------------------------------------lsdAvasvt


                         -         -         -         -         *         -         -:420
query           NHLKTIIGGVKDSTNRVTGACNSMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLSA
PF00015         aeiadlvqeiaaaseeqsasieevnqaveeidevtkenaalveeaaaaaetleeqaeeleelva------
PF00015         aeiadlvqeiaaaseeqsasieevnqaveeidevtkenaalveeaaaaaetleeqaeeleelva------
PF02743         ----------------------------------------------------------------------
PF00672         erLr---------------------------------------------rrLaeaarriae..Gdlddrv
PF00672         erLr---------------------------------------------rrLaeaarriae..Gdlddrv
PF00672         erLr---------------------------------------------rrLaeaarriae..Gdlddrv
PF07889         kqlekvseslaatkkhLsqridnlddkldeqkeiskeikeevtevredlsnikedvksvqqvvegL----
PF07889         kqlekvseslaatkkhLsqridnlddkldeqkeiskeikeevtevredlsnikedvksvqqvvegL----
PF07889         kqlekvseslaatkkhLsqridnlddkldeqkeiskeikeevtevredlsnikedvksvqqvvegL----
PF07889         kqlekvseslaatkkhLsqridnlddkldeqkeiskeikeevtevredlsnikedvksvqqvvegL----


                         -         -         +         -         -         -         -:490
query           QHGQEEIGEVIGAMEGIKSSTNEISRAISEVENQSKKIQHITTIITQIAEQTNLLALNAAIEAARAGEHG
PF00015         -------ekAvaemekieksveeaveaveeleksskkIsdiisVIdeIadQTNlLALNAaiEAARAGeqG
PF00015         -------ekAvaemekieksveeaveaveeleksskkIsdiisVIdeIadQTNlLALNAaiEAARAGeqG
PF02743         ----------------------------------------------------------------------
PF00672         .pvdgrdEigeLar--------------------------------------------------------
PF00672         .pvdgrdEigeLar--------------------------------------------------------
PF00672         .pvdgrdEigeLar--------------------------------------------------------
PF07889         ------------------atkkhLsqridnlddkldeqkei-----------------------------
PF07889         ------------------atkkhLsqridnlddkldeqkei-----------------------------
PF07889         ------------------atkkhLsqridnlddkldeqkei-----------------------------
PF07889         ------------------atkkhLsqridnlddkldeqkei-----------------------------


                         *         -         -         -         -         +         -:560
query           KGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNEMVEMGSQRVQEAGEVFKTITINI
PF00015         rGFaVVAdEVrkLAersaqaakeieklieeivkeindsveslqevrteveegselveetgealkeIveav
PF00015         rGFaVVAdEVrkLAersaqaakeieklieeivkeindsveslqevrteveegselveetgealkeIveav
PF02743         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF07889         ---------lekvseslaatkkhLsqridnlddkldeqkeiskeikeevtevredlsnikedvasvtkql
PF07889         ---------lekvseslaatkkhLsqridnlddkldeqkeiskeikeevtevredlsnikedvasvtkql
PF07889         ---------lekvseslaatkkhLsqridnlddkldeqkeiskeikeevtevredlsnikedvasvtkql
PF07889         ---------lekvseslaatkkhLsqridnlddkldeqkeiskeikeevtevredlsnikedvasvtkql


                         -         -         -         *         -         -         -:630
query           EELVEKMAQITRATITMSASIQNVAAASQEQAAIIEEENKMVEDLRQSAIVLDNMVQKFVV---------
PF00015         aeiadlvqeiaaaseeqsasieevnqaveeidevtkenaalveeaaaaaetleeqaee------------
PF00015         aeiadlvqeiaaaseeqsasieevnqaveeidevtkenaalveeaaaaaetleeqaee------------
PF02743         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------
PF07889         ekvseslaatkk...hLsqridnlddkldeqkeiskeikeevtevredlsnikedvk-------------
PF07889         ekvseslaatkk...hLsqridnlddkldeqkeiskeikeevtevredlsnikedvk-------------
PF07889         ekvseslaatkk...hLsqridnlddkldeqkeiskeikeevtevredlsnikedvk-------------
PF07889         ekvseslaatkk...hLsqridnlddkldeqkeiskeikeevtevredlsnikedvk-------------