[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49801.1


[Show Plain Result]

## Summary of Sequence Search
   1::916
 623::736  PF02518 0.0% 46.7289719626168  Histidine kinase-, DNA gyrase B-, and HSP90-like AT 
 795::905  PF00072 0.0% 42.5925925925926  Response regulator receiver domain 
 508::575  PF00512 0.0% 42.4242424242424  His Kinase A (phosphoacceptor) domain 
 189::259  PF00672 0.0% 26.4705882352941  HAMP domain 
   1::916


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLKTKLFLGLSGLFIILLLISGSAIYGMKKFNNNIEEIVKNRYQKVILVATIQFEINNASRYLRDLILE
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DNNTDLEIYNKMEESNKQILGAISALEKVSEVDELKQLTTEVKTAFNEYLKIEKTIYSLVQAGRRDEAKA
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VLYQNASVQTRLKLVQMIDDVGSIQQKQMELTVAQSKDVYNNIVFIFISLVLIGMVLGSGIVVWLIQNIV
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ------------------------------------------------vvlllalllalvlawllarril


                         -         -         -         +         -         -         -:280
query           GNLHRVTLAMKSVSSHKDKTFLPRLDIVSSDEIGKISEVFNDMVEALEQHARQEKEKNLAIQEQHWLKSK
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         rPlrrLaeaarria.eGdld..drvpvdgrdEigeLarafnamlerLre---------------------


                         -         *         -         -         -         -         +:350
query           VAEIMTLFQGVLDVKTFAQLLITRIPPIVGGCYGVFYVSVTEGEEQRLIKMASYASGGQDVGTSSFRPGE
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GLVGQCLLENKVIYLTNIPNQYIHITSGLGTAPAKCITVLPVEFEGKVVAVIELASFTELSSLQQELLEQ
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VRWNVGISLNRIGNHMQVQKLLADSQALTEELQTQSEELQMQQEELKTFNEKLENQYKESEQKTIELQKA
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KTALEEQASHLALSSQYKSEFLSNMSHELRTPLNSLLILARILVENKDGNLSPKQVEYAETILSSGNDLL
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         -----------------lgrflagvsHELrtPLtailgnaeller..vgelteeelrealeiirdeaerl
PF00672         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           NLINDIFDLAKIEAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNRLMQI
PF02518         --------------------------------------------------------------dedrlrqi
PF00072         ----------------------------------------------------------------------
PF00512         raliedlLdlsriea-------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LKNLLSNAFKFTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGG
PF02518         vselvdNavkateesgeievrvkree......gelvieVeDnGiGipeedlervfepffqtdd.dsrkvg
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           TGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIPTYDVETEFIEPARTEVAPGDDNSPIERDEIGKTE
PF02518         gtGlGlsivkklvellggeieveskeggGttvtlrl----------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           EWSGDKVSLSQIYSQGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDL
PF02518         ----------------------------------------------------------------------
PF00072         ------------------------vlivdDeplvrellrqalekegyeevaeaddgeealellkekd.pD
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           VLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVW
PF02518         ----------------------------------------------------------------------
PF00072         lillDiempgmdGlellkeireee..pklpiivvtahgeeedalealkaGakdflsKpfdpeelv-----
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           LYRKVN----------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF00672         ----------------------------------------------------------------------