[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49907.1


[Show Plain Result]

## Summary of Sequence Search
   1::277
  54::271  PF00497 0.0% 38.5321100917431  Bacterial extracellular solute-binding proteins, fa 
   1::277


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKRGLWFLVLVLTLALVTMGCGGGEKEKQAANQEPAKQTEKNTLDQIKEKGVIVAGLDDTFAPMGYRDE
PF00497         -----------------------------------------------------lkvgtdadypPfsfkde


                         -         -         *         -         -         -         -:140
query           SNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQ
PF00497         ngklsGfdvdlakaiakrlgvklefvevsfddlipalesgkvDiaiaaisitpeRekkvdFsqpyftagl


                         +         -         -         -         -         *         -:210
query           IMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIKEVKLYKTYPEAFTDLQIGRIPVVVCDRIT
PF00497         vilvrkkdakkissiksladLkgkkvgvqagttaedllkeelkkgakvveyddleealaaLaagrvdavv


                         -         -         -         +         -         -         -:280
query           ASHYISKRADTYEIVGEKITDEPLAIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK---
PF00497         adspvlaylvkknggkklvvvdeplegeeyaiavrkgdseLrkainkalaelkedgtldki---------