[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49938.1


[Show Plain Result]

## Summary of Sequence Search
   1::640
   6::127  PF00535 0.0% 34.4262295081967  Glycosyl transferase family 2 
 208::230  PF07719 0.0% 34.7826086956522  Tetratricopeptide repeat 
 251::275  PF07719 0.0% 36  Tetratricopeptide repeat 
 276::305  PF07719 0.0% 36.6666666666667  Tetratricopeptide repeat 
 325::353  PF07719 0.0% 34.4827586206897  Tetratricopeptide repeat 
 421::445  PF07719 0.0% 24  Tetratricopeptide repeat 
 583::614  PF07719 0.0% 40.625  Tetratricopeptide repeat 
 250::275  PF00515 0.0% 30.7692307692308  Tetratricopeptide repeat 
 278::305  PF00515 0.0% 32.1428571428571  Tetratricopeptide repeat 
 322::349  PF00515 0.0% 35.7142857142857  Tetratricopeptide repeat 
 395::412  PF00515 0.0% 27.7777777777778  Tetratricopeptide repeat 
 583::614  PF00515 0.0% 34.375  Tetratricopeptide repeat 
   1::640


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGNRISLCMIVKNEEGNIRRCLASVTGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEWNNNFSDARNFS
PF00535         -----sviiptyNeekylletlesllaqtyenfeiivvDDgStDetkeileeyaksdlrvrvirleknvG
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYR
PF00535         kagarnaglkkakgdyilflDaDdepdpdwleklveklekdgadvvigsrvrifget-------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FRGAIHEQIADVILEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHY
PF00535         ----------------------------------------------------------------------
PF07719         -------------------------------------------------------------------ynl
PF07719         -------------------------------------------------------------------ynl
PF07719         -------------------------------------------------------------------ynl
PF07719         -------------------------------------------------------------------ynl
PF07719         -------------------------------------------------------------------ynl
PF07719         -------------------------------------------------------------------ynl
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHY
PF00535         ----------------------------------------------------------------------
PF07719         GlayyklgdyeeAleafekA--------------------ayyklgdyeeAleafekAleldPnnaealy
PF07719         GlayyklgdyeeAleafekA--------------------ayyklgdyeeAleafekAleldPnnaealy
PF07719         GlayyklgdyeeAleafekA--------------------ayyklgdyeeAleafekAleldPnnaealy
PF07719         GlayyklgdyeeAleafekA--------------------ayyklgdyeeAleafekAleldPnnaealy
PF07719         GlayyklgdyeeAleafekA--------------------ayyklgdyeeAleafekAleldPnnaealy
PF07719         GlayyklgdyeeAleafekA--------------------ayyklgdyeeAleafekAleldPnnaealy
PF00515         ---------------------------------------naylklgkydeAieyyekALelnPnn--aly
PF00515         ---------------------------------------naylklgkydeAieyyekALelnPnn--aly
PF00515         ---------------------------------------naylklgkydeAieyyekALelnPnn--aly
PF00515         ---------------------------------------naylklgkydeAieyyekALelnPnn--aly
PF00515         ---------------------------------------naylklgkydeAieyyekALelnPnn--aly


                         -         *         -         -         -         -         +:350
query           YGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD
PF00535         ----------------------------------------------------------------------
PF07719         nlGlayyklgdyeeAleafekAlel-------------------ynlGlayyklgdyeeAleafekAlel
PF07719         nlGlayyklgdyeeAleafekAlel-------------------ynlGlayyklgdyeeAleafekAlel
PF07719         nlGlayyklgdyeeAleafekAlel-------------------ynlGlayyklgdyeeAleafekAlel
PF07719         nlGlayyklgdyeeAleafekAlel-------------------ynlGlayyklgdyeeAleafekAlel
PF07719         nlGlayyklgdyeeAleafekAlel-------------------ynlGlayyklgdyeeAleafekAlel
PF07719         nlGlayyklgdyeeAleafekAlel-------------------ynlGlayyklgdyeeAleafekAlel
PF00515         nlGnaylklgkydeAieyyekALel----------------kalynlGnaylklgkydeAieyyekALe-
PF00515         nlGnaylklgkydeAieyyekALel----------------kalynlGnaylklgkydeAieyyekALe-
PF00515         nlGnaylklgkydeAieyyekALel----------------kalynlGnaylklgkydeAieyyekALe-
PF00515         nlGnaylklgkydeAieyyekALel----------------kalynlGnaylklgkydeAieyyekALe-
PF00515         nlGnaylklgkydeAieyyekALel----------------kalynlGnaylklgkydeAieyyekALe-


                         -         -         -         -         *         -         -:420
query           NPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSS
PF00535         ----------------------------------------------------------------------
PF07719         dPn-------------------------------------------------------------------
PF07719         dPn-------------------------------------------------------------------
PF07719         dPn-------------------------------------------------------------------
PF07719         dPn-------------------------------------------------------------------
PF07719         dPn-------------------------------------------------------------------
PF07719         dPn-------------------------------------------------------------------
PF00515         --------------------------------------------naylklgkydeAieyyek--------
PF00515         --------------------------------------------naylklgkydeAieyyek--------
PF00515         --------------------------------------------naylklgkydeAieyyek--------
PF00515         --------------------------------------------naylklgkydeAieyyek--------
PF00515         --------------------------------------------naylklgkydeAieyyek--------


                         -         -         +         -         -         -         -:490
query           AEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDT
PF00535         ----------------------------------------------------------------------
PF07719         aealynlGlayyklgdyeeAleafe---------------------------------------------
PF07719         aealynlGlayyklgdyeeAleafe---------------------------------------------
PF07719         aealynlGlayyklgdyeeAleafe---------------------------------------------
PF07719         aealynlGlayyklgdyeeAleafe---------------------------------------------
PF07719         aealynlGlayyklgdyeeAleafe---------------------------------------------
PF07719         aealynlGlayyklgdyeeAleafe---------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYH
PF00535         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDRS
PF00535         ----------------------------------------------------------------------
PF07719         ----------------------ealynlGlayyklgdyeeAleafekAleldPn----------------
PF07719         ----------------------ealynlGlayyklgdyeeAleafekAleldPn----------------
PF07719         ----------------------ealynlGlayyklgdyeeAleafekAleldPn----------------
PF07719         ----------------------ealynlGlayyklgdyeeAleafekAleldPn----------------
PF07719         ----------------------ealynlGlayyklgdyeeAleafekAleldPn----------------
PF07719         ----------------------ealynlGlayyklgdyeeAleafekAleldPn----------------
PF00515         ----------------------kalynlGnaylklgkydeAieyyekALelnPn----------------
PF00515         ----------------------kalynlGnaylklgkydeAieyyekALelnPn----------------
PF00515         ----------------------kalynlGnaylklgkydeAieyyekALelnPn----------------
PF00515         ----------------------kalynlGnaylklgkydeAieyyekALelnPn----------------
PF00515         ----------------------kalynlGnaylklgkydeAieyyekALelnPn----------------


                         -         +         -         -         -         -         *:700
query           EKIKGEVPLE------------------------------------------------------------
PF00535         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------