[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49955.1


[Show Plain Result]

## Summary of Sequence Search
   1::426
  79::350  PF01925 0.0% 27.5555555555556  Sulfite exporter TauE/SafE 
   1::426


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRGLYEALMSASRAHAKWELEMSNNIIRNRKHLLVLALMMLPLVIPAIGHAADLPGFIGGKSAYGPSHYN
PF01925         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PMMFYGSMAVGICAGLITGCIGAGGGFVITPALMSLGVKGILAVGTDQFHIFAKAIMGTVIHKKLGNVNV
PF01925         --------lagllaGflagltGfGggliavPlLlll.lpppvavatsllavlvtslvgalahrrrgnvdw


                         +         -         -         -         -         *         -:210
query           ALAIAFLVGSGIGVTAGGTLNRALFNMNPVLSDFIISLVYVVMLGFLGFYSMYDFIKNKNTSGDAHGGPE
PF01925         rlllplllgallGallGalllsllp.......sellkllfgvlllllallmll...rkkraaek......


                         -         -         -         +         -         -         -:280
query           GMTKLAQKLQGVNIAPMVKFDEDIVPGGRKISGWFVAFCGAVVGFAAAIMGVGGGFLTFPMFVYGLGVSS
PF01925         ............................grlrrpslilllllgglvvGflsgllGiggGvllvpllllll


                         -         *         -         -         -         -         +:350
query           FTTVGTDILQIIFTAGYSSIAQYAVYGYIFYTLAMGMLVGSLLGIQIGAATTKVVSGIYIRAFYAIAIMA
PF01925         glplkkavatsll.vflvislagllgy.vlgyvdwpllllvllllpgallGallGarlarrlsertlrrl


                         -         -         -         -         *         -         -:420
query           GFVNRAFALPEKMAQMGYISIAKENGVLFSNIGAWVFFGLILIFAVWIILSFIRGLPILRAETAEASMAS
PF01925         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GKGVSH----------------------------------------------------------------
PF01925         ----------------------------------------------------------------------