[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50036.1


[Show Plain Result]

## Summary of Sequence Search
   1::240
 146::186  PF00165 0.0% 24.390243902439  Bacterial regulatory helix-turn-helix proteins, Ara 
 199::236  PF00165 0.0% 40.5405405405405  Bacterial regulatory helix-turn-helix proteins, Ara 
  19::82   PF02311 0.0% 28.125  AraC-like ligand binding domain 
   1::240


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDELRNILCERRIYTNSCLSHAHSFGQLLLPLQGTLFIETNLHRVRLDNKHLFFLPPGDNHTFYSKDKNE
PF00165         ----------------------------------------------------------------------
PF00165         ----------------------------------------------------------------------
PF02311         ------------------pphvhdeyvihyvteGtgrlrlngrtydlgpGdlfLlppgepHdyesdsedg


                         -         -         *         -         -         -         -:140
query           FLVLDIPASLLPEQNYKNMDGGVYLPLDQRWESLRFLFLSETGAHSKPNPSLHDLFRYASRLLYNFDQPV
PF00165         ----------------------------------------------------------------------
PF00165         ----------------------------------------------------------------------
PF02311         weyrwlyfegel----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SIQYVQNHYQEKISLEYLAALEHYNPSYYCQWFQKKTGLSPLAFIQKLRLEKAKYLLINTDFSLLRIAQE
PF00165         -----eenlstnwsiadiAeevgfSpsyfsrlFkkytGvtPsqyrr------------stnwsiadiAee
PF00165         -----eenlstnwsiadiAeevgfSpsyfsrlFkkytGvtPsqyrr------------stnwsiadiAee
PF02311         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VGYEQQSSLARLFRQKEGMSASDYRKAFQR----------------------------------------
PF00165         vgf.SpsyfsrlFkkytGvtPsqyrr--------------------------------------------
PF00165         vgf.SpsyfsrlFkkytGvtPsqyrr--------------------------------------------
PF02311         ----------------------------------------------------------------------