[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50098.1


[Show Plain Result]

## Summary of Sequence Search
   1::307
   7::279  PF02653 0.0% 27.2030651340996  Branched-chain amino acid transport system / permea 
   1::307


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTSIWLGVLEQGLLWGVMVLGVYITFRVLDFPDLTVDGSFTLGAAVAARMIIEGQDPWLGTLLALFAGA
PF02653         ------fnlltqaailgiaAlGlalvf.iagvinlghgglmalg.ayvaalllnlllsllllallvaflv


                         -         -         *         -         -         -         -:140
query           AAGFVTGFLNTRLRIAPLLSGILMMIALYSINLRVMGNKSMISLLRMDNIYTDVANIGVPAGMAVLTFGL
PF02653         gaavglllgllvlrlkvdeviitlllnsilvglvlllleggtggikgqsgskellgfapallsflsaviv


                         +         -         -         -         -         *         -:210
query           VIITLTTYLLYAFLQTEIGMALRATGDNEQMIRSLGVNTNSTKILGLSMGNALVAMSGALVAQYQSYSDV
PF02653         ..llalllvlavllllyrtrfGralravgeneeaaralGinvkrvklltfvisgalAglaGallalllgs


                         -         -         -         +         -         -         -:280
query           GMGIGMIVVGLASVIVGEVVIGKRTLLRTLVAVLIGSIIYRAVIAAVMQLGLPTTDLKLFTALLVIFAMS
PF02653         idpnigvglgfnaiaavvlGga........gsllgtvigaliigllsslgltllgiptelarvllgall-


                         -         *         -         -         -         -         +:350
query           SPLIKEKLSAPPGRAKGSVDHAVNSGN-------------------------------------------
PF02653         ----------------------------------------------------------------------