[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50205.1


[Show Plain Result]

## Summary of Sequence Search
   1::474
  27::311  PF07690 0.0% 28.7272727272727  Major Facilitator Superfamily 
 296::417  PF07690 0.0% 24.7933884297521  Major Facilitator Superfamily 
  45::199  PF00083 0.0% 25.6756756756757  Sugar (and other) transporter 
 286::401  PF00083 0.0% 25.2252252252252  Sugar (and other) transporter 
  46::420  PF05977 0.0% 22.0385674931129  Bacterial protein of unknown function (DUF894) 
  39::197  PF06609 0.0% 30.4635761589404  Fungal trichothecene efflux pump (TRI12) 
   1::474


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSQAASTDIQENKVNKYTLAALAGVPLIMVLGNSMLIPVLPQMAKSLNVSQMQISLIITLFSVPAGLVIP
PF07690         --------------------------flaalarsilgpalplalaedlgispseigwlltlyslgyaias
PF07690         --------------------------flaalarsilgpalplalaedlgispseigwlltlyslgyaias
PF00083         --------------------------------------------e....ssvlsglivssflvgaliGsl
PF00083         --------------------------------------------e....ssvlsglivssflvgaliGsl
PF05977         ---------------------------------------------slsasplmValvqaaatLPifllsl
PF06609         --------------------------------------alpnilqdvgqsens.slfstlwttgqavsil


                         -         -         *         -         -         -         -:140
query           FAGFLSDRFGRKKIIIPGLFLYGLGGLLAGAAALIFKENAFPWILGGRILQGIGAAGTAPIAMAFCGDLW
PF07690         llaGrlsdrfGrrrvlllglllfalglllll.fa....sslwalllvlrvlqGlgagalfpagaaliadw
PF07690         llaGrlsdrfGrrrvlllglllfalglllll.fa....sslwalllvlrvlqGlgagalfpagaaliadw
PF00083         faglladrfGRkksllvalvlfvigavlqaaakak...ksvwvlivgRvivGlgvGlisvlvPmyisEiA
PF00083         faglladrfGRkksllvalvlfvigavlqaaakak...ksvwvlivgRvivGlgvGlisvlvPmyisEiA
PF05977         laGvlaDnldrRkvllvvqlllllasvlltvlaal..gllspwlllaltfllgiGaalnapaWqasvgel
PF06609         vmgrltdrfgrrpfvilt.hilglvgaivgcta.....tkfntllaamtllgv.aagpagasplfvgelm


                         +         -         -         -         -         *         -:210
query           KGKERAKSLGVIEASNGLGKVASPILGALIGLIAWWYIFFFFPVVIAVVILGVWFICKEPETNKQPKKVN
PF07690         fpkeergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrks
PF07690         fpkeergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrks
PF00083         pkklrgalgslyqlaitvGilvaaiiglglnktsnadgwrillglqlvpallllllllf-----------
PF00083         pkklrgalgslyqlaitvGilvaaiiglglnktsnadgwrillglqlvpallllllllf-----------
PF05977         vkrddvpaAvaLnsvgvNiaRsvGPAlgGvlvaavgaalafavnalsylavivalarwkrevrksalpr.
PF06609         snktkflgllivsipvvvtsglspylgqrlaiqgswrwifyiyiitsaiavllivvw-------------


                         -         -         -         +         -         -         -:280
query           EYVGSIKNIFKKKSPLLLTSFFAGSAALLILFGVLFFLSDYLEKKFGLDGVIKGAALAIPVLFMSTTSYV
PF07690         paeelrkepaplvpawklllkpp.vlwllialllfffvfsg...lltllplylqevlglspglllaglll
PF07690         paeelrkepaplvpawklllkpp.vlwllialllfffvfsg...lltllplylqevlglspglllaglll
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF05977         .EkllaalraglRytaaSrelksvlvraalFglsasavlaLLPlvardelggdalvyGillga....l.G
PF06609         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TGALIKKKIKLMKWLVVIGHGLIGASLVTLPLFNNVYIFFAGISVAGIGTGLVLPCLNTLITSSTNKDER
PF07690         gllaligaigalllglllglllfalg.lllllfasslwalllvlrvlqGlgagalfpagaaliadwfpke
PF07690         gllaligaigalllglllglllfalg.lllllfasslwalllvlrvlqGlgagalfpagaaliadwfpke
PF00083         -----kksllvalvlfvigavlqaaakak....ksvwvlivgRvivGlgvGlisvlvPmyisEiApkklr
PF00083         -----kksllvalvlfvigavlqaaakak....ksvwvlivgRvivGlgvGlisvlvPmyisEiApkklr
PF05977         aGAvlgalllsrlrrrlsserlvllaavalAlvllslalssslwvavlvlllgGaaWiaalstlnvavql
PF06609         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GLVTSLYGSVRFLGVAAGPPLFGWLVEKGSDMMFWASASLAVISAVLAFFFIKVKAIQTSQGNNYDSSKQ
PF07690         ergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrksp---
PF07690         ergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrksp---
PF00083         galgslyqlaitvGilvaa.iiglglnktsnadgwrillglqlvpalllll-------------------
PF00083         galgslyqlaitvGilvaa.iiglglnktsnadgwrillglqlvpalllll-------------------
PF05977         avprWvrgRalsvYltvlaGglaaGsllWGtvaealslelaLllaavalllgallllllrlpegeea...
PF06609         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KQSKQTLIMPVKQPFIAYKSLAWHPESNLIVRKPMPQMKKERINEVGQVNTGES----------------
PF07690         ----------------------------------------------------------------------
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF06609         ----------------------------------------------------------------------