[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50272.1


[Show Plain Result]

## Summary of Sequence Search
   1::198
  18::160  PF04055 0.0% 25  Radical SAM superfamily 
   1::198


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRQFIISYQIDETLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCG
PF04055         -----------------vvtrgCnlrCsfCanpet....sregrgrsrsveeileevkelkeekgvkevt


                         -         -         *         -         -         -         -:140
query           YGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNATVYTEICR
PF04055         ltGgepllypdfvellerlaklalpgirialetngtlpd...eeileelaelgvdrvslglesgdeekvl


                         +         -         -         -         -         *         -:210
query           PADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEACETIAQNLGTEFRLRKPTL------------
PF04055         klmrrghtfeevlealeklr--------------------------------------------------