[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50378.1


[Show Plain Result]

## Summary of Sequence Search
   1::223
  30::69   PF09335 0.0% 15  SNARE associated Golgi protein 
  68::183  PF09335 0.0% 31.8965517241379  SNARE associated Golgi protein 
   1::223


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKHPILLVIFFTVCFFYLWGNEVLNIFKIVFSSDIQKAVELIRTAGSKAVLISIFINVAISLMGVMPSV
PF09335         -----------------------------llsekrveklkkverlverygfsallllrllPivprdlPse
PF09335         -----------------------------llsekrveklkkverlverygfsallllrllPivprdlPse


                         -         -         *         -         -         -         -:140
query           FLTGANLIIFGLNKGFLVSWAGEVIGAAISFLLYRWGITSVAKLSTEQWKLFKTINSLPPLKQTYFLFIL
PF09335         vllvaaGvlfglllgtlvtslgallgallayllgrylgkkalrrkllsekrveklkkverlverygfsal
PF09335         vllvaaGvlfglllgtlvtslgallgallayllgrylgkkalrrkllsekrveklkkverlverygfsal


                         +         -         -         -         -         *         -:210
query           RMAPFIPSGLINLFGAITSVSLLNFLIATTAGKFPALLLETAFSYHLITLGRNYIYVGISILIALLLYLG
PF09335         lllrllPivprdlvnyvaGltrvsfkrFllatfigsipwafly---------------------------
PF09335         lllrllPivprdlvnyvaGltrvsfkrFllatfigsipwafly---------------------------


                         -         -         -         +         -         -         -:280
query           IKKEMRRLEKQYE---------------------------------------------------------
PF09335         ----------------------------------------------------------------------
PF09335         ----------------------------------------------------------------------