[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50573.1


[Show Plain Result]

## Summary of Sequence Search
   1::446
 100::294  PF00448 0.0% 51.2820512820513  SRP54-type protein, GTPase domain 
 325::425  PF02978 0.0% 55.4455445544554  Signal peptide binding domain 
   5::82   PF02881 0.0% 38.6666666666667  SRP54-type protein, helical bundle domain 
 110::252  PF01656 0.0% 26.6129032258065  CobQ/CobB/MinD/ParA nucleotide binding domain 
 100::147  PF01583 0.0% 35.4166666666667  Adenylylsulphate kinase 
 228::252  PF01583 0.0% 36  Adenylylsulphate kinase 
  94::205  PF06414 0.0% 17.4311926605505  Zeta toxin 
 102::134  PF03205 0.0% 39.3939393939394  Molybdopterin guanine dinucleotide synthesis protei 
 102::249  PF02492 0.0% 23.4042553191489  CobW/HypB/UreG, nucleotide-binding domain 
   1::446


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFKGLGERLDEIFKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAVGQDVLESLSP
PF00448         ----------------------------------------------------------------------
PF02978         ----------------------------------------------------------------------
PF02881         ----LkkglsktrnkltgklfltekkidelleeleeaLleaDVgvevvkkliervreklvg...kkgvsp
PF01656         ----------------------------------------------------------------------
PF01583         ----------------------------------------------------------------------
PF01583         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AQQVIKIVRDELTELLGGTQAKINLSPKPPTIIMLVGLQGAGKTTTAGKLAKLLSKQGRRPLMVAGDIYR
PF00448         -----------------------------pnvillvGlqGaGKTTtlaKLAallkkegkkvllvaaDtfR
PF02978         ----------------------------------------------------------------------
PF02881         keeikkilkdeL----------------------------------------------------------
PF01656         ---------------------------------------GvGKTtlaanLaralakrglrVlliDlDpqa
PF01583         -----------------------------gvvvwltGlsgsGKstiavalekkLvekgikvylLdGdnvR
PF01583         -----------------------------gvvvwltGlsgsGKstiavalekkLvekgikvylLdGdnvR
PF06414         -----------------------vpeqekpkavllgGqpGAGKtslaellleela..agnivridaDelr
PF03205         -------------------------------ivlvvGpkdsGKTTliekllnilkergyrvavv------
PF02492         -------------------------------vtvltGflGsGKTtLleklle.knraglkiavivndfge


                         +         -         -         -         -         *         -:210
query           PAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANSTGRDLVIIDTAGRLHINEELMDELANIKSTV
PF00448         aaAveQLktlaeklgvpvikekeekdpaavakeavekakeekidvvlvDTaGrlqndkelmeelkkikkv
PF02978         ----------------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF01656         nnssllgkveilkkglekasal.........lenfeagllaegeeglvesllkkalealikea.yDvvii
PF01583         hgLnkdL---------------------------------------------------------------
PF01583         hgLnkdL---------------------------------------------------------------
PF06414         kyh.payrelekkdpkeaseltqkdaselveklidralekgyniilegtlrspdkarkiarklkk-----
PF03205         ----------------------------------------------------------------------
PF02492         .tsiDaellretgveivelnnGciCctlredllmelealeelkerldvlliEttG.laepaplld....l


                         -         -         -         +         -         -         -:280
query           RPHEILLVVDAMTGQEAVNVADTFNQKLGLDGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDAL
PF00448         lkpdevllvldatigqealkqakaFkeaveltgviltklDgdakgGaalsiaaelklPikfigvGekied
PF02978         ----------------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF01656         Dgapglgel.........vanalqaadllvvviepekfsveg----------------------------
PF01583         -----------------stiavalekkLvekgikvylLdGdn----------------------------
PF01583         -----------------stiavalekkLvekgikvylLdGdn----------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF02492         ksdlgldavvavvdvknltegedkpekledqlaaAdlii-------------------------------


                         -         *         -         -         -         -         +:350
query           EPFYPDRMADRILGMGDVLTLIEKAQANFDAEQAAKLNKKIRQADFNLEDFLEQMQQVKKLGPLEQVLGM
PF00448         leefdperlvsrll--------------------------------------------------------
PF02978         --------------------------------------------kftledfleqlkqikkmGslkkllkm
PF02881         ----------------------------------------------------------------------
PF01656         ----------------------------------------------------------------------
PF01583         ----------------------------------------------------------------------
PF01583         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IPGMGKLTKQLKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ
PF00448         ----------------------------------------------------------------------
PF02978         lPglgslakdlpeekeeqaaekelkkleaiidSMTkkErqnpelledsRvrRiakGsGtsveevneLlkq
PF02881         ----------------------------------------------------------------------
PF01656         ----------------------------------------------------------------------
PF01583         ----------------------------------------------------------------------
PF01583         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TRKMMKQISNMTKGGKKGKMKLPFFQ--------------------------------------------
PF00448         ----------------------------------------------------------------------
PF02978         fkqmk-----------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF01656         ----------------------------------------------------------------------
PF01583         ----------------------------------------------------------------------
PF01583         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------