[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50700.1


[Show Plain Result]

## Summary of Sequence Search
   1::635
   2::168  PF00009 0.0% 40.9638554216867  Elongation factor Tu GTP binding domain 
 587::634  PF09107 0.0% 60.4166666666667  Elongation factor SelB, winged helix 
 450::505  PF09106 0.0% 42.8571428571429  Elongation factor SelB, winged helix 
 614::630  PF09106 0.0% 29.4117647058824  Elongation factor SelB, winged helix 
 194::260  PF03144 0.0% 35.8208955223881  Elongation factor Tu domain 2 
   6::176  PF02421 0.0% 28.8461538461538  Ferrous iron transport protein B 
   8::73   PF09439 0.0% 36.6666666666667  Signal recognition particle receptor beta subunit 
  15::116  PF01926 0.0% 36.0824742268041  GTPase of unknown function 
   1::635


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKHIIIGTAGHVDHGKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVDVPGHEKFIKN
PF00009         -kirnigiighvDhGKtTltdallykagaiskrgeeaeaerlldklkeerergiTiksaaisleletkkr
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF02421         -----valvGnpnvGKttlfnaltgak...qkvgNwpGvTVekkegklklkg.keveivDLPGiYsLsay
PF09439         -------lvGlsdsGKTslftrLttd......svkktvtSqessaalkvksekgkkltliDfPGheklrq
PF01926         --------------GKStLinaltgk..akakvanypgtTrdpnegkvkledgkeitliDtpGiiegadk


                         -         -         *         -         -         -         -:140
query           MLAGVGGIDLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTKIDMVDEEWLSLVTEEIREYLKDTV
PF00009         linliDtPGHvdFskevirglrvlDgavlvvdaveGvepqteevlrlakklgvk.iivviNKiDrvdeae
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF02421         seeekvardyll.eekpdviinvvDasn....lernLyLtlqllelgvpvvvalnmiDeaekkgikidlk
PF09439         kll-------------------------------------------------------------------
PF01926         kegelgkkflealeeadllllvvdase...pltkndleladlelek------------------------


                         +         -         -         -         -         *         -:210
query           LSEAPVVPVSSTTKQGIPQLLDLIDQFVDDTEERNSSGKLRLPIDRVFSVTGFGTVVTGTLLSGRVSTGD
PF00009         leevveelkekllekylekgeeevpvip------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF03144         -----------------------------------------------------GtvatgrvysGtlkkGd
PF02421         kLselLg......vpvvktvarkkkgieelleaiie----------------------------------
PF09439         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TVEIMPLGTVSRVRSIQVHGKKVEQARAGQRTAVNIIGVEVEEVKRGSVLVTPNSVEPSHRMDVKFLLLE
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF03144         tvrilgndtskkeivtrvrsletfngdldeavaganaGvivaikgledai--------------------
PF02421         ----------------------------------------------------------------------
PF09439         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SAEKPLKNRARVRLYLGTDEILGRVRLLDREEIEPNQEAYVQLELEERGIAGKGDRFVIRSYSPMRTIGG
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF09439         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GVVIEPNAPKHKRYRSEVLEGLATKEKGTPEELVNQLLAGKQGLFSPEEIIEATGLAGDDLKISIEKLQS
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF09439         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           EQQVKCIPVDKKSLYIAQFTYNKWRQEIKSMVINYHREYPLREGYPKEELRSRKFPFINNKHFQYLLQAM
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         -----------------------------aaLaeyHeknPlrpGigkeeLrsrlalpglpeklfqalLea
PF09106         -----------------------------aaLaeyHeknPlrpGigkeeLrsrlalpglpeklfqalLea
PF03144         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF09439         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EIDGLLKLHDKTLALAEFTGELSGSQQKLVQDMICAIQEGNFQPPSWVEVVKKFRLKDAESQEYLQYFLR
PF00009         ----------------------------------------------------------------------
PF09107         ----------------------------------------------------------------------
PF09106         llaegrlksegawlh-------------------------------------------------------
PF09106         llaegrlksegawlh-------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF09439         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TGQLVKLSDDELYYTADRYQQAKTKIVEYLKENKEISVAQTRDLLKTSRKFTLPLLETMDRERLTRRVGD
PF00009         ----------------------------------------------------------------------
PF09107         --------------------------rallaengeitvaefRdalglSRKyaiplLEyfDreglTrRkgd
PF09106         -----------------------------------------------------PlrpGigkeeLrsrlal
PF09106         -----------------------------------------------------PlrpGigkeeLrsrlal
PF03144         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF09439         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           NRVLV-----------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF09107         kRvl------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF09106         ----------------------------------------------------------------------
PF03144         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF09439         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------