[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50704.1


[Show Plain Result]

## Summary of Sequence Search
   1::586
  15::519  PF02652 0.0% 35.6435643564356  L-lactate permease 
   1::586


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMWEQIITPFENQYLSAFVASIPISFLFFTLYSRVRIHIAGFLTLLVTTGVAIFVYGMPFKLAAWSSFYG
PF02652         --------------lsalvalvPIlllllalavlklkgykaallslavtviiallvykmpvekvlaavlk


                         -         -         *         -         -         -         -:140
query           GMTGMFSIGWIMLSSLFLYKLTVKTGQIHIITWSIQSITRDHRLQCLLVALCLGAFLENLAGYSTSVAIT
PF02652         galsgllpialviiaavflyklsvksgafeiirksilsispdrriqvlligfafgaflEGaaGfGtpvAI


                         +         -         -         -         -         *         -:210
query           SGILVALGFRPIYAAVLCLITSISFGFMGVPIITAGLTSDIDMMAVSQMVGRQLPILSFLLPFWLVFILA
PF02652         saalLvglGfkPlyaaglcLIantapvafGavGiPitagagatklsaleisslvgiilvlislliplllv


                         -         -         -         +         -         -         -:280
query           GWKGTKEVWLPILVCGISFAGVQWFAANYIFLSIVNTLAAVTTMIIMVFFLRNWQPKDVWHSQKTSSFYP
PF02652         illdgvkdiketfpavlvsglsfaiaqflisnvlGpelpsilgalvslvilalflkafqpkeifrfagke


                         -         *         -         -         -         -         +:350
query           NEKISFSTVLSAWLPYIIMTIFIINWSFKPVQDFLNTFTVYVAVSTLNNTIIASGKPIEVYLSLSLLSSV
PF02652         eskekselkaakilkAlsPfvllvavivltsipllkalfeeggllatkllsleleelskliikikpivee


                         -         -         -         -         *         -         -:420
query           GTVIFISAIINAYIYKVCHKELITLLGQAVRNLFLPLVGISLIIGVSYLMNWSGMIASMANVIASANGLL
PF02652         atalevvfklkllsspgtiillaallsiavlklsskdalkvlketlkelklpilaiilvlalanlmnvsG


                         -         -         +         -         -         -         -:490
query           PMFAPILGWLGVFITGSDVSSNTLMAKLQANTAQIVGFDPVLTVAANHSGGAVAKMISPEAIGAAASATG
PF02652         lsktlalalaetGsaftllspllGalGvfltGSdtvsNllFgslQletaeqiglsevlllaantvGgvvg


                         *         -         -         -         -         +         -:560
query           LNGREDDIFSYTLTHSLFFLSFLCFLTYLQAYTFKWLIPSYHKVLGITAEMVNYKIEGYKLMILMLGLVL
PF02652         kmispqsiaiacaavglvgkEsdllrktv-----------------------------------------


                         -         -         -         *         -         -         -:630
query           VLALFSSKLKGKDNKQNEHTNRVKTL--------------------------------------------
PF02652         ----------------------------------------------------------------------