[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50753.1


[Show Plain Result]

## Summary of Sequence Search
   1::394
  59::372  PF01094 0.0% 22.6229508196721  Receptor family ligand binding region 
   1::394


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKHFRLAALLVALVMLAGLVSGCGGGGEEKKAADANEIVIGGNLELSGPVATFGTAMKNGAEMYFEEVN
PF01094         ----------------------------------------------------------leAmelAieeiN


                         -         -         *         -         -         -         -:140
query           AAGGVLGKKIKFNVMDNKSDATEAANVATRLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTA
PF01094         adgs.llpgitlgaeiddtcsddsfavaaaacllksrgvvaviGpscssvsdavarlanlfniPqisyga


                         +         -         -         -         -         *         -:210
query           LEVTVDPNTKKVRDYVFRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGG
PF01094         tspelsds...knryptfaRtvpsdtkqaqaivdiikh.fgWnkvallyddddy.gegglealeeelrea


                         -         -         -         +         -         -         -:280
query           KIVGEEAFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEIA
PF01094         glncvakvsekisndsdaeellkelkdikskarvivlfcssedarqilqaavelgmnsgeyvwilsdlws


                         -         *         -         -         -         -         +:350
query           GGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIKRSEDASPEKIKEA
PF01094         dslldelnekaeeaaegvlgftlv...spnspgfreflerlkklanqneteasdeeisafallvyDaVyl


                         -         -         -         -         *         -         -:420
query           LANAKDVQAITGKLSFDENHNPIKGAVILEMKDGKQVYKTYVQP--------------------------
PF01094         lahAlnkllredpdqtrglkwe------------------------------------------------