[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50761.1


[Show Plain Result]

## Summary of Sequence Search
   1::227
 126::215  PF01555 0.0% 43.75  DNA methylase 
   1::227


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDKLKMHSINKVEDNIKKIGELFPNAITEVIKGYREDGSPIIEQAIDFDVLRQELSSVLVEGPAERYQFT
PF01555         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           WPDKRKSILLANAPIAKTLRPYREESVDFDNTENLYIEGDNLDALKLLQETYLGKVKMIYIDPPYNTGND
PF01555         -------------------------------------------------------vdlivtdpPYntgkd


                         +         -         -         -         -         *         -:210
query           FIYEDDFAQDADEYLANSGQYDENGNRLVQNTESNGRFHTDWLNMIYPRLKLAKDLLTEDGAIFISIDDN
PF01555         y..............endeqyeeeds............yeeyleflekvlkevrrvLkddgsifinidds


                         -         -         -         +         -         -         -:280
query           EVENLNLKSESSFPSLT-----------------------------------------------------
PF01555         eikke-----------------------------------------------------------------