[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50766.1


[Show Plain Result]

## Summary of Sequence Search
   1::80
   7::70   PF08291 0.0% 46.875  Peptidase M15 
   4::72   PF05951 0.0% 37.6811594202899  Bacterial protein of unknown function (DUF882) 
   1::80


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEELFKLASNYRCPPHNRAVGGAVNSLHLKGMAADIRVLEMTAKEITHLAEKAGFDGIGLYPSQCFVHVD
PF08291         ------isSgyRspklnravgGaktsqHltgkAaDitvlgknaeelaeilraerpkdigieeknsfvHvd
PF05951         ---eiqvvsgyrsPatnallrsrskgvakksyhmlGkaidfrldgvklkklreialklqvGGvGyyPksg


                         -         -         *         -         -         -         -:140
query           VRGYCARWEG------------------------------------------------------------
PF08291         ----------------------------------------------------------------------
PF05951         sp--------------------------------------------------------------------