[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50796.1


[Show Plain Result]

## Summary of Sequence Search
   1::200
  23::91   PF04542 0.0% 42.0289855072464  Sigma-70 region 2 
 130::181  PF08281 0.0% 51.9230769230769  Sigma-70, region 4 
 134::183  PF04545 0.0% 34  Sigma-70, region 4 
   8::185  PF07638 0.0% 29.8780487804878  ECF sigma factor 
 151::188  PF08280 0.0% 28.9473684210526  M protein trans-acting positive regulator (MGA) HTH 
 143::181  PF00196 0.0% 38.4615384615385  Bacterial regulatory proteins, luxR family 
   1::200


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLEDQLLVERSKKGDREAFEHLVRLYENKVYTIAYRLMGNHADASDLAQDAFIKIYQALPNFRGDSSFS
PF04542         ----------------------lverylplvrrlarrllgsgadaeDlvQeaflrllraverfdpergvk
PF08281         ----------------------------------------------------------------------
PF04545         ----------------------------------------------------------------------
PF07638         -------lleqvkdGdaeaaeqllelvydeLrrlagsklknerreetledtaLvfeaflrlvdkekfpdl
PF08280         ----------------------------------------------------------------------
PF00196         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TWIYHITVNVCRDELRKRQRRPTVSLDDNSSDSNNSNTYEIRSNDPGPEEMLDRSETQAMIQACLNTLSD
PF04542         fsawlltiirnaildalrrrr-------------------------------------------------
PF08281         -----------------------------------------------------------alrealaeLpe
PF04545         ---------------------------------------------------------------aLasLpe
PF07638         sgrdhlfalaaeamrrilidhaRrrkrqkRGGdvvraeldee.eds.......vds..dspdelleLdea
PF08280         ----------------------------------------------------------------------
PF00196         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DYREIIVMREIQELAYEEIAEILGCSLGTVKSRLSRARQALKEKISKQMELITPAKRLAK----------
PF04542         ----------------------------------------------------------------------
PF08281         rqreifllryleglsykEIAellgisegtVksrlsRArkkL-----------------------------
PF04545         rerevlelrfgeglTleEiGerlgisrerVrqiekrAlrkLRk---------------------------
PF07638         ...ler.llsldpeqarlvelrkleGlsveEiAeklgvskrtver-------------------------
PF08280         ----------eksitldelakeLglseltLksyiseLqelFpeelsiv----------------------
PF00196         --RErevLrllaaGksnkeIAdeLgiSekTVkvhrsnimrK-----------------------------