[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50877.1


[Show Plain Result]

## Summary of Sequence Search
   1::233
  39::100  PF01965 0.0% 42.1052631578947  DJ-1/PfpI family 
  38::94   PF07685 0.0% 40.7407407407407  CobB/CobQ-like glutamine amidotransferase domain 
  33::163  PF00117 0.0% 26.1904761904762  Glutamine amidotransferase class-I 
   1::233


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFGVVVFPGSNCDADCLHAIKTVTGQPVDYIWHKSGSVDGYDCIVLPGGFSYGDYLRCGAVARFSPVMS
PF01965         --------------------------------------dd.ydalvlPGGhaaaedlrad....aeklve
PF07685         -------------------------------------lledadlvilpGgkntlqdl...allresglde
PF00117         --------------------------------le...klknpdgilisgGpgspga.........vegki


                         -         -         *         -         -         -         -:140
query           PVIEFARRGGLVLGICNGFQVLTEAGLLPGALHRNKNLSFLCHDTYLRVENDISPFTSLASRGSVIKVPI
PF01965         lvkefaaagkpiaaiChgpvlLaaagllkg----------------------------------------
PF07685         alkeaaeaggpvlgiCGGyqmLge----------------------------------------------
PF00117         eaikearenkiPiLGICLGmQllaiefgg...................................kvikek


                         +         -         -         -         -         *         -:210
query           AHGEGNYFADSDTVRRLEENNQVVFRYCDYNGEITQGVNPNGSVNNIAGICNEQGNVLGMMPHPERCAEE
PF01965         ----------------------------------------------------------------------
PF07685         ----------------------------------------------------------------------
PF00117         keehmggnmrlghdgkaallygl-----------------------------------------------


                         -         -         -         +         -         -         -:280
query           ILGNIDGQLIFKSLLETWQRRCG-----------------------------------------------
PF01965         ----------------------------------------------------------------------
PF07685         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------