[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50885.1


[Show Plain Result]

## Summary of Sequence Search
   1::513
  10::191  PF00117 0.0% 32.967032967033  Glutamine amidotransferase class-I 
 421::512  PF00958 0.0% 60.8695652173913  GMP synthase C terminal domain 
  74::174  PF07722 0.0% 31  Peptidase C26 
 208::390  PF02540 0.0% 24.2603550295858  NAD synthase 
 210::269  PF00733 0.0% 30.5084745762712  Asparagine synthase 
 220::254  PF03054 0.0% 47.0588235294118  tRNA methyl transferase 
 220::282  PF01171 0.0% 34.9206349206349  PP-loop family 
 219::327  PF02568 0.0% 29.2452830188679  Thiamine biosynthesis protein (ThiI) 
   1::513


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLAEQELILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAPTV
PF00117         ---------lliDnydsvtknlaralrelgvkvevvpndadaeeileklknpdgilisgGpgspgavegk
PF00958         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DPAVYELDIPVLGICYGMQLMTQQLKGKVVPAEMREYGRTTLRVMQCDNILKNLTADEECWMSHGDRVEE
PF00117         ieaikearenkiPiLGICLGmQllaiefggkvikekkeehmggnmrlghdgkaallyglpnevivrhrHs
PF00958         ----------------------------------------------------------------------
PF07722         ---alergvPvlgiCrGlqllnvalggtlyqdikeepglsdhreheqdasshavsle.kgsllarllgae
PF02540         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPKGMEVLKSFLFDICGCSGSWSMGSFLDEAVK
PF00117         yevnpkellpeglevtaksedggeimaivekknpivgvQFHPEssstpggp-------------------
PF00958         ----------------------------------------------------------------------
PF07722         eievnslHhqaikelakglevlAtaedgvieaie------------------------------------
PF02540         -------------------------------------------------------------------flk
PF00733         ---------------------------------------------------------------------d
PF03054         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EVKQRVGNRQVLCALSGGVDSSVAAVLVHRAVGDNLTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVD
PF00117         ----------------------------------------------------------------------
PF00958         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF02540         eyvkksgakgvvlGlSGGvDSalvaalavkalgkenvlalimP.ssvsseedvedalalaeklgieskti
PF00733         avkrrlradvpvgvlLSGGlDSsliaalaaresskplktfsvgfeeseadea.gyaelv-----------
PF03054         ---------kvvvalSgGVDSsvaalllkeqg.yevigvfmknw--------------------------
PF01171         ---------kvlvAvSGGlDSmaLlkllkklkkklgiklvavhvdhglreeskeeaelveelckklnipl
PF02568         --------gkvlaLlSgGiDSpVaaylllkR.Gcevvlvhfkneplkseeaeekvrklaellaeyktele


                         -         *         -         -         -         -         +:350
query           ASERFLGKLQGVTDPEQKRKIIGTEFIRVFEEEARKLGEIDFLVQGTLYPDVVESGTATAEVIKSHHNVG
PF00117         ----------------------------------------------------------------------
PF00958         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF02540         dikeivaafse.eleeek.......eklakgNlkaRiRmillyaiankl.nllvlgTsnksEllvGyfTk
PF00733         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF01171         ei--------------------------------------------------------------------
PF02568         vklvvvdfk.kvqkeileklkekllivllkrvmlkvAekvaeeeg.a-----------------------


                         -         -         -         -         *         -         -:420
query           GLPEDMKFDLVEPLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVT
PF00117         ----------------------------------------------------------------------
PF00958         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF02540         yG...Dgacdl.apiaellKtevyeLakrlnvPervikka------------------------------
PF00733         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DEIKNAGLNREIWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDVLGNISTRLVN
PF00117         ----------------------------------------------------------------------
PF00958         eelkkaglykkvwqafavllpvksvGvqgdkRtysyvvvlRavetsdfmtadvaelplevLeeiskrivn
PF07722         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EVAEINRVVYDITSKPPGTIEWE-----------------------------------------------
PF00117         ----------------------------------------------------------------------
PF00958         evegvsrVvyditsKPPaTiEw------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF02568         ----------------------------------------------------------------------