[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50894.1


[Show Plain Result]

## Summary of Sequence Search
   1::256
  67::240  PF01739 0.0% 41.3793103448276  CheR methyltransferase, SAM binding domain 
   2::54   PF03705 0.0% 32.0754716981132  CheR methyltransferase, all-alpha domain 
 172::229  PF08242 0.0% 25  Methyltransferase domain 
   1::256


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTINVSE
PF01739         ------------------------------------------------------------------neTe
PF03705         -adferfrellykrtGidltdyKralvkrRLerrmralglesfaeYlelLesdp----------------
PF08242         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDNTILQAA
PF01739         ffReakhfeelekkvlepllakakksrrvriWsagcssGeEpYslAmllaealpkalklkvkilAtDidl
PF03705         ----------------------------------------------------------------------
PF08242         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKGYDLIACRNVTIYFTRE
PF01739         kalekAkagvypeeeleglpeelleryfeeseeesykvkkeikelvlFeklnllekksvlsklDvifcRn
PF03705         ----------------------------------------------------------------------
PF08242         -------------------------------ennnnnnvnlealdlldldggssfDvvvasnvlhhl..k


                         -         -         -         +         -         -         -:280
query           AQDKVNARFAQSLNPGGYLFIGGSETIFNYAEIGFEKVSPCFYRKK------------------------
PF01739         vliYfdeetqekilerfaealkpgGlLflG----------------------------------------
PF03705         ----------------------------------------------------------------------
PF08242         direvldnirklLkpgGrl---------------------------------------------------