[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50917.1


[Show Plain Result]

## Summary of Sequence Search
   1::337
  99::180  PF01706 0.0% 20  FliG C-terminal domain 
 220::327  PF01706 0.0% 55.5555555555556  FliG C-terminal domain 
   9::46   PF03448 0.0% 18.9189189189189  MgtE intracellular N domain 
 117::182  PF03448 0.0% 21.6666666666667  MgtE intracellular N domain 
 243::293  PF03448 0.0% 19.6078431372549  MgtE intracellular N domain 
   1::337


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNQYEKLTGEQKAAILLISLGADVSSKLLKQEFTEDEVEKVTAAIAEMDKVPNDIQKQVVEEFIYLIQAR
PF01706         ----------------------------------------------------------------------
PF01706         ----------------------------------------------------------------------
PF03448         --------pkeeaaevleelsedlqeeliea.lpdeelaelleeld------------------------
PF03448         --------pkeeaaevleelsedlqeeliea.lpdeelaelleeld------------------------
PF03448         --------pkeeaaevleelsedlqeeliea.lpdeelaelleeld------------------------


                         -         -         *         -         -         -         -:140
query           DYLLNGGVNYAKELLEKTYGYDKGSEILERISSTMQSVPFGSLRKTDPRHILSFIREEHPQTIAFVLSYL
PF01706         ----------------------------eeirkkm..FtFedlvrlddraiqrllrevdkevLalALkga
PF01706         ----------------------------eeirkkm..FtFedlvrlddraiqrllrevdkevLalALkga
PF03448         ----------------------------------------------sedlqeeliealpdeelaelleel
PF03448         ----------------------------------------------sedlqeeliealpdeelaelleel
PF03448         ----------------------------------------------sedlqeeliealpdeelaelleel


                         +         -         -         -         -         *         -:210
query           KPDQAAVILAELDSQLQSEVARRVAILDRISPDVAKEVEKVLEKKLASVAQHEETVVGGVQCLVNILNRV
PF01706         seelrekilsnmSkRaaemlreeleelgpvklsdveaaqk------------------------------
PF01706         seelrekilsnmSkRaaemlreeleelgpvklsdveaaqk------------------------------
PF03448         dsDdavdlleelpeekveell......saldeeereeieell----------------------------
PF03448         dsDdavdlleelpeekveell......saldeeereeieell----------------------------
PF03448         dsDdavdlleelpeekveell......saldeeereeieell----------------------------


                         -         -         -         +         -         -         -:280
query           DRSTEKTIFEDLERADPNLSEEVRRLMFIFEDIVKLHDISIQKVLREVDNKDLALAMKGSNQEVNNRIYK
PF01706         ---------eaLeeedpelaeeirkkmFtFedlvrlddraiqrllrevdkevLalALkgaseelrekils
PF01706         ---------eaLeeedpelaeeirkkmFtFedlvrlddraiqrllrevdkevLalALkgaseelrekils
PF03448         --------------------------------iealpdeelaelleeldsDdavdlleelpeekveells
PF03448         --------------------------------iealpdeelaelleeldsDdavdlleelpeekveells
PF03448         --------------------------------iealpdeelaelleeldsDdavdlleelpeekveells


                         -         *         -         -         -         -         +:350
query           NMSKRASEMLKEEIDYMGPVRLKDVEEAQQRIVNVIRRLEEAGEIVISRGGEDAILV-------------
PF01706         nmSkRaaemlreeleelgpvklsdveaaqkeivatvrelaeeGeiel-----------------------
PF01706         nmSkRaaemlreeleelgpvklsdveaaqkeivatvrelaeeGeiel-----------------------
PF03448         aldeeereeieel---------------------------------------------------------
PF03448         aldeeereeieel---------------------------------------------------------
PF03448         aldeeereeieel---------------------------------------------------------