[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO50988.1


[Show Plain Result]

## Summary of Sequence Search
   1::387
  96::136  PF00395 0.0% 50  S-layer homology domain 
 177::194  PF00395 0.0% 35.2941176470588  S-layer homology domain 
 229::272  PF00395 0.0% 34.8837209302326  S-layer homology domain 
   1::387


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKVGKGIITLAVASSLLVGGAMADAAPGGNGKGSSDKSSKPSSSQVQKSSSQSNSGTQNKSVNGVEIKE
PF00395         ----------------------------------------------------------------------
PF00395         ----------------------------------------------------------------------
PF00395         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TKTNKANNDKKFGEVQSKVKYAAKDFKDTQNHWAKGPIQRLQMLGIASGFPDGTFQPEAPVTQEQVVSMV
PF00395         -------------------------FkDvdkipwawa.eaiqalaalGivsGysdgtFkPnnpiTR----
PF00395         -------------------------FkDvdkipwawa.eaiqalaalGivsGysdgtFkPnnpiTR----
PF00395         -------------------------FkDvdkipwawa.eaiqalaalGivsGysdgtFkPnnpiTR----


                         +         -         -         -         -         *         -:210
query           VRTLELQGEEINETTNETDEITTEQTEATEEELEDVPNWARGAVAEAKAKGIINLNRFHSGVQASRVQSM
PF00395         ------------------------------------dkipwawa.eaiqalaal----------------
PF00395         ------------------------------------dkipwawa.eaiqalaal----------------
PF00395         ------------------------------------dkipwawa.eaiqalaal----------------


                         -         -         -         +         -         -         -:280
query           VWLAKAMDLEPVETTGLPFKDGILVSPEDMGYVMALYKEGLVAGGPGGMLNPNSAVTRAQIAALIDRMLT
PF00395         ------------------FkDvdkipwawa.eaiqalaalGivsGysdgtFkPnnpiTRaEa--------
PF00395         ------------------FkDvdkipwawa.eaiqalaalGivsGysdgtFkPnnpiTRaEa--------
PF00395         ------------------FkDvdkipwawa.eaiqalaalGivsGysdgtFkPnnpiTRaEa--------


                         -         *         -         -         -         -         +:350
query           EEQTEDTDTFQGVETADGQQVLKIGTGENAEEIKLADEVEIYINGELAELSDLVKGTAVKVETNEEGLAI
PF00395         ----------------------------------------------------------------------
PF00395         ----------------------------------------------------------------------
PF00395         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KIEQTVEESTTEDDTTVEEETDNTAENSTEDTDNINS---------------------------------
PF00395         ----------------------------------------------------------------------
PF00395         ----------------------------------------------------------------------
PF00395         ----------------------------------------------------------------------