[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO51003.1


[Show Plain Result]

## Summary of Sequence Search
   1::247
  18::240  PF04452 0.0% 46.8181818181818  RNA methyltransferase 
   1::247


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPRFFVQPEQINSDTAVINGPDVKHISRVLRMETGNNLTLLDGRGNVYLAQILEINKQEVHCRILEQQEA
PF04452         -----------------ltdeeahHlvkVlRlkegdeiklfdgdgkeylaeieeiskkkvevkilekeee


                         -         -         *         -         -         -         -:140
query           TSEPTVKVTLVQGLPKGDKMETIIQKCTELGVSSIIPLAAARSIVKLDAKKAAERVQRWQRVAVEAAKQC
PF04452         ekeepekitlaqalpkgdklelilqkatElGvseivplisersvvklkekkkekklerwqkiaieAaeQs


                         +         -         -         -         -         *         -:210
query           RRSGIPEVYMLSSWDEILQQIPPDALVLMPWEGERTKSLREVLQTRPMAPGQVYIFIGPEGGFEEEEVER
PF04452         grtvlPevkepislkelleelkeadl.lilheeekksleelsekkkelkev..kvllliGPEGGfseeEi


                         -         -         -         +         -         -         -:280
query           VKEKGFYPVTLGSRILRTETAGPAALTMVLYQFGELG---------------------------------
PF04452         ellkeagfkpvsLgpriLRteTAalaalsa----------------------------------------