[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO51163.1


[Show Plain Result]

## Summary of Sequence Search
   1::204
   9::200  PF01865 0.0% 21.9895287958115  Protein of unknown function DUF47 
   1::204


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFFKKTDIFFETFKAIAENITRAAEDFSAEIHNPSSDKRGLTNLQNYEKTGDRYTHTIIKELNKTFVTPL
PF01865         --------liehlekvvetvlkleellealirgdyekveellkeiselEeeADeikreirlklesglflP


                         -         -         *         -         -         -         -:140
query           EREDIMNLAVKLDDILDGIEATMIRMDIYDIKDMNIFIKRNTEIILEQCQEVEKSIGKLVTKRFLEIRTH
PF01865         vdRedllelvellDkiaDaaediakllllkkvsipeelkdeflallkksvkaaellaeaieelekllesa


                         +         -         -         -         -         *         -:210
query           AVRINELENEADHLFNNSLRELVASCNDAIQFIKYKQIYEMLEEVTDACEDVANILESILMRNS------
PF01865         l.sekeivkeieelEdeiDqlqekllkklfsredasnpldvlilleiieklsnvsDraed----------