[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO48556.1


[Show Plain Result]

## Summary of Sequence Search
   1::371
   1::352  1.7e-37 27.6% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   1::342  3.4e-34 22.9% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   1::341  1.4e-33 27.5% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   1::341  2.4e-22 24.7% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   1::341  2.4e-21 21.9% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   1::371


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDVTNWESNHTVI
00503371   1/1  MmlkslelknfkslkdvsligdfspgltaivGpNGsGKStlldaiagllgpdsgeirldgkdlliylsdl
00390411   1/1  MknlslrygnfralkdvslelppGltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrgadkas
00509431   1/1  MlelknlslsnfrvlkdelvslefepgltaivGpNGsGKStlldalagllggrslrllragglsdliflg
00367901   1/1  lelknlslsygksilkdvsleipgeltalvGpnGsGKStllkalagllgpdvsallrlsglidlilkgll
00466931   1/1  MkllslslgnfralkdvslelpgeltalvGpNGsGKStLlkalagllgpds...................


                         -         -         *         -         -         -         -:140
query           NTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLSLIKGSPQERRHFLDYEVGTL
00503371   1/1  irrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeliellldlsgg
00390411   1/1  velvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgiglvpq
00509431   1/1  slirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrligyvpqdp
00367901   1/1  llprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfpqltvl
00466931   1/1  .........................................................Geilldgkdilal


                         +         -         -         -         -         *         -:210
query           SPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDEQLYRYGAKVIYLRLQVLKKLIPIARKTHFG
00503371   1/1  elnrvalllqgevdlllldepterldfldelag..leeykgnyeellklleeleellkelekrlelleke
00390411   1/1  ehdlfplltvaenialldelagl..pkygnylsllkeklkelnallkelelqlkelarllelleglkee.
00509431   1/1  nllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeele..........
00367901   1/1  enlllglelrrklldellgllel.....lalleellklleellke..........levleaalaallkee
00466931   1/1  speellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallldlll


                         -         -         -         +         -         -         -:280
query           LTGGTEELQAKYLSSLVLEPGLSEGQIYQVFSSSSKKIRQMELKRCQTLLGPHRDDLSLAINGVEAKTFG
00503371   1/1  leeleellerlealekaleeleerlkeleelkdkleeleeelealeeqiaeleeelsekrllaleklskl
00390411   1/1  aekakalleelkele...............klllayllqlleilllllltlleallgllraelearalel
00509431   1/1  ......................................................................
00367901   1/1  ieeraeellell............glgglldrpvstL.................................
00466931   1/1  llllllllllllllllvlllllllllvlllll..llalllllalkeaallleelllllglgdlldrpvst


                         -         *         -         -         -         -         +:350
query           SQGQQRTVTLSLKLSQLDLWYHEFGEYPVLLLDDVLFELDRSRQNMLIDKILNKVQTFITTSFTGGIEET
00503371   1/1  fneilkellkg.............................gslelelerlgerlalvglngsgkdtllkl
00390411   1/1  lervglpgdlldrpvst......LSGGekqrlalAralalaella...kdpplllLDEPtag--------
00509431   1/1  ........ligplldglellvglnglldrpl.selSgGekqrlalaralalael.....kd---------
00367901   1/1  .....................SgGekqrvalaralallel.....ldpplllLDEptsgLD---------
00466931   1/1  LSGGerqrvalaralalalll...lsdpplllLDEPtagLDpetreellellkelakegkt---------


                         -         -         -         -         *         -         -:420
query           IKGAGLLWQVNAGSLTQKEEF-------------------------------------------------
00503371   1/1  vg--------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------