[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO48569.1


[Show Plain Result]

## Summary of Sequence Search
   1::151
   1::152  3.7e-50 46.1% 0051482 00514821 1/1   ine deaminase-like                      
   1::152  4.1e-50 45.0% 0050730 00507301 1/1   ine deaminase-like                      
   1::150  2.3e-48 45.3% 0051891 00518911 1/1   ine deaminase-like                      
   1::152  4.2e-48 44.4% 0050639 00506391 1/1   ine deaminase-like                      
   1::152    2e-47 44.1% 0052851 00528511 1/1   ine deaminase-like                      
   1::130  2.5e-47 47.7% 0051727 00517271 1/1   ine deaminase-like                      
   2::151  4.6e-45 47.5% 0053055 00530551 1/1   ine deaminase-like                      
   1::146  1.7e-44 44.6% 0050283 00502831 1/1   ine deaminase-like                      
   3::151  2.6e-44 47.1% 0044240 00442401 1/1   ine deaminase-like                      
   2::151    3e-44 45.3% 0051897 00518971 1/1   ine deaminase-like                      
   1::125  2.1e-28 26.4% 0041046 00410461 1/1   ine deaminase-like                      
   1::129  6.5e-27 28.1% 0052747 00527471 1/1   ine deaminase-like                      
   1::103  2.2e-23 33.0% 0035093 00350931 1/1   ine deaminase-like                      
   1::116  1.8e-15 21.7% 0039755 00397551 1/1   ine deaminase-like                      
   1::92   9.9e-14 22.5% 0052373 00523731 1/1   ine deaminase-like                      
   7::109  4.5e-11 22.3% 0043140 00431401 1/1   ine deaminase-like                      
   1::103  2.4e-08 28.6% 0035094 00350941 1/1   ine deaminase-like                      
   1::151


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSHALFMREALIEAQKAAVKGEVPIGAVVVWKDEVIGRGYDLRESLCDASAHAEILAMRKAAKHLGDWRL
00514821   1/1  selpeddeyfmrlAlelarraltygnvpvGAvivkdgeiiatgynrenaggdptaHAEinAirqaakllg
00507301   1/1  lddeyfmrlAlelarraltygnvpvGAvivddgeiiatgynrvnagldptaHAEinAirqaarllggyrl
00518911   1/1  meldeyfmrlAlelarralpygnfpvGAvivkdgeiiatgynrvnaggdptaHAEinAirqaarllgger
00506391   1/1  mlsddeyfmrlAlelarralapgsefpvGAvivkdgeiiatgynvengsydptaHAEinAirqaarklgg
00528511   1/1  lssllplllkallldlllsdlrleldeyfmrlAlelArraldagnvpvGAvivdpsdgeiiatgynrvlg
00517271   1/1  addeyfmrlAlelarralplgnvpvGAvivkdgeiiatgynlenasgdptaHAEinAirqaarllggrrl
00530551   1/1  -ldeyfmrlAlelArralgltagnvpvGAvivkdgeiiatgynrv....dgtaHAEvnAlrqaar..gge
00502831   1/1  mddeyfmrlAlelArrs.tdpnppvGAvivkdgeiiatgyngvpsgnalclevlallelllallglllld
00442401   1/1  --leldeyfmrlAlelarraldlgnvpvGAvivdkkdgeiiargynrvlggndptaHAEinalrqaar.l
00518971   1/1  -ldeyfmrlAlelArraldlgevnPlvGAvivkdgeiiatgynrvl....ptaHAEvnAlrqa.....gv
00410461   1/1  eedelllalaleaakrayapyskfpvGAalltedgriytGvnvenaaygltlcAErvAilnavlagerkl
00527471   1/1  ldeedeellelAleaakkayapysefpvGAalltddgriytGvnvenasygltlcAErvAiakavaa.ge
00350931   1/1  mderlkllleqlelslasylpdlfgpkdllglitallldkllkllrleddelllalaleaanrayapysn
00397551   1/1  eeldklieaaleaanrayapyskfpvGAalltkdGkiytGvnvenaaynltlcAervAlanavla.gerk
00523731   1/1  ldlelllqaaleaaklayaPyskfpvGAalltedgriytGvnvenaaygltlcAervAiakavlager..
00431401   1/1  ------kltgledeelealleaaleaaerayapysnfpvGAalltedgriytGvnvenasygltlcAErv
00350941   1/1  aqevnslrsyLPdafgPkdlliksllldpvdhgltlsddelieaaleaaerayaPyskfpvGaalltkdg


                         -         -         *         -         -         -         -:140
query           NDATLYVTVEPCAMCAGAIVQFRINRLVYGAPNAKSGSVDTILNIVQEARFNHRVEVIAGILEDQCKEII
00514821   1/1  gyrlkgatlyvtlePCpmCagaiieagikrvvygasdpdlgalgsgldllpeaflnhgieviggvleeea
00507301   1/1  kgatlyvtlePCpmCagaiieagikrvvygasdpdlgalgsgldllrlaglnvrveviggll.eealall
00518911   1/1  lkgatlyvtlePCpmCagaiieagikrvvygasdpdlgalgsgldllpeaflnhgievivgvleeealal
00506391   1/1  erlkgatlyvtlePCpmCagaiieagikrvvygasdpdlgvlg.llglllleslgievevlggvleeeal
00528511   1/1  sgdptaHAEinAlrqaarllggvrlakylltgatlYvTlePCpmCagaiiqagikrvvygasdpdagalg
00517271   1/1  kgatlyvtlePCpmCagaiieagikrvvygasdpdlgalgsgldllpeaglnvrlgvleg----------
00530551   1/1  rlkgatlyvTlePCshlgktpmCagaiiqagikrvvygaldpdlgvagglllll.....nagievvvgvl
00502831   1/1  gglprlldlesldglllslllllsgelleldptaHAEinAirqaak.lg.erlkgatlYvTlePCpmCag
00442401   1/1  ggellkgatlYvTlePCpmCagaiiqagikrvvygasdpdlgglgll........lnagievvvgvleee
00518971   1/1  llkgatlyvTlePCsmlgktPpCagaiiqagikrvvygasdpdlgvagsglellr....nagievvvgvl
00410461   1/1  kaivvvgdtlyvtlsPCgmCrqvllefgidtvvylanddgevavvtlsellpdaf---------------
00527471   1/1  rklkaiavvvdtggvtlsPCgmCrqalaefgidtvvylalddgagavvtlleLlPlafg-----------
00350931   1/1  fpvGAvlvtddgriytGanvenaaynllrtlhA-------------------------------------
00397551   1/1  lkaivvvedsdgvlsPcgmCrqvllelagpdllvllvnldgevkvv------------------------
00523731   1/1  .eivaiavvadsdgvlsPcgaC------------------------------------------------
00431401   1/1  AifkavsegerkllalivvagdseggvlsPCgmCrqvla-------------------------------
00350941   1/1  riytGvnvenaaynptlcaeraAifka..vseg-------------------------------------


                         +         -         -         -         -         *         -:210
query           QNFFRELRKNK-----------------------------------------------------------
00514821   1/1  lallrgffkrlr----------------------------------------------------------
00507301   1/1  kgffkrlreklp----------------------------------------------------------
00518911   1/1  lrdffkrrrp------------------------------------------------------------
00506391   1/1  ellrgffkrlrk----------------------------------------------------------
00528511   1/1  lleasglellll----------------------------------------------------------
00517271   1/1  ----------------------------------------------------------------------
00530551   1/1  eeealellkdf-----------------------------------------------------------
00502831   1/1  aiiqag----------------------------------------------------------------
00442401   1/1  aiellkgfflr-----------------------------------------------------------
00518971   1/1  eeealellldf-----------------------------------------------------------
00410461   1/1  ----------------------------------------------------------------------
00527471   1/1  ----------------------------------------------------------------------
00350931   1/1  ----------------------------------------------------------------------
00397551   1/1  ----------------------------------------------------------------------
00523731   1/1  ----------------------------------------------------------------------
00431401   1/1  ----------------------------------------------------------------------
00350941   1/1  ----------------------------------------------------------------------