[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO48689.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
 209::332  2.5e-13 24.5% 0047791 00477911 1/1   -helical ferredoxin                     
 207::332  1.4e-12 26.5% 0045859 00458591 1/1   S ferredoxins                           
 184::333  1.9e-12 20.6% 0048346 00483461 1/1   -helical ferredoxin                     
 201::333  1.6e-11 28.6% 0052034 00520341 1/1   -helical ferredoxin                     
 219::332  4.2e-08 32.9% 0052779 00527791 1/1   S ferredoxins                           
 226::321  4.2e-07 25.0% 0040210 00402101 1/1   S ferredoxins                           
 209::320  1.5e-06 27.3% 0037513 00375131 1/1   S ferredoxins                           
 226::320  2.2e-06 27.8% 0039453 00394531 1/1   S ferredoxins                           
 219::326  5.7e-06 32.2% 0039666 00396661 1/1   S ferredoxins                           
 219::320  5.1e-05 31.2% 0039142 00391421 1/1   S ferredoxins                           
 219::320  5.2e-05 17.0% 0038361 00383611 1/1   S ferredoxins                           
 196::320  6.7e-05 20.5% 0047184 00471841 1/1   S ferredoxins                           
 216::332  0.00012 20.4% 0038466 00384661 1/1   -helical ferredoxin                     
 226::320  0.00024 30.9% 0045037 00450371 1/1   S ferredoxins                           
 226::319  0.00052 37.0% 0038470 00384701 1/1   S ferredoxins                           
 226::320   0.0007 34.8% 0035614 00356141 1/1   S ferredoxins                           
 301::320     0.13 40.0% 0044815 00448152 2/2   S ferredoxins                           
 220::241     0.24 36.4% 0044815 00448151 1/2   S ferredoxins                           
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MILNKSETASLLDKLANEYRVIAPVEKEGLVQFAAIQKGEEAKLDYMNAKKPGKEILFPQSEELYSYTVD
00477911   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00520341   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00471841   1/1  ----------------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AEGVRMQDNVDPKATIVFGMRPCDVKSMVLLDNVFKNDQYEDVYYLTRRANTLIVGLGCNEPSATCFCSS
00477911   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00520341   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00471841   1/1  ----------------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           MSCGPFAKEGSDIFLTDIGEAYVVEGISEKGKELLAKLGLAEASAEAKGQAAKLQEETKADGSVNIEGLA
00477911   1/1  --------------------------------------------------------------------lc
00458591   1/1  ------------------------------------------------------------------llpl
00483461   1/1  -------------------------------------------lsvffdllksikpllapdvtlapp..k
00520341   1/1  ------------------------------------------------------------dlspfldkll
00527791   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00375131   1/1  --------------------------------------------------------------------lg
00394531   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00471841   1/1  -------------------------------------------------------lllllllalcplvcp
00384661   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EKLGGMFEHPYWDSLYEKCLGCGACTYLCPTCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSGHNPR
00477911   1/1  ifcglcvlacpllaldvtvtypleallsperfrplidldkCigCgaCvaaCPtgaitpd......flgpr
00458591   1/1  ekldilrpvividl..dkCigCgaCvavCpvgaitlvllgpracilc.pacvkvcptgallklegggrvv
00483461   1/1  ellqspedrrklidl.dkCigCgaCvaaCPvyaitgde.....flgprglicalrlladprd........
00520341   1/1  aicpglgpctgvcpelaeilvdperpkilidldkCigCgaCvaaCPtgaitgd.................
00527791   1/1  --------cPlgalvlldngrgdislpivvid..edkCigCgaCvaaCPt.gait.gdealdprgri...
00402101   1/1  ---------------hlclegicggcgfcilacptgalddggsvkilidlskCigCgaCvaaCptelllp
00375131   1/1  aklkldlllglvvidedkCigCgrCvraCpvgaitlvlllllr...........................
00394531   1/1  ---------------llvvidldkCigCglCvraCpvgaivlvell........................
00396661   1/1  --------vavid..edkCigCghcedaaCvevCPv..................................
00391421   1/1  --------rmrvvvdedkCigCgaCvaaCpvg..............aivlddglcvrvcptg........
00383611   1/1  --------qkgilidldkCigCgaCvvaCkeenil..palllarrvlellpaallplaallvlllelgvv
00471841   1/1  lgalpllslglvvidedkCigCglCvaaCp.vgaivlelekg............................
00384661   1/1  -----laaglgavididkclgcgacvvacpvel..............nlpvgkllgrlyvprievpeldp
00450371   1/1  ---------------edkCigCglCvaaCPv..............gaisldglglerlv...........
00384701   1/1  ---------------edkCigCglCvraCPv.gaislveldpeg..........................
00356141   1/1  ---------------llidldkCigCgaCvlaCpvgaillvee...........................
00448152   2/2  ----------------------------------------------------------------------
00448151   1/2  ---------lkvvvdedkCigcglCvlvCpv---------------------------------------


                         -         *         -         -         -         -         +:350
query           PGGKARWRQRLMHKFNYFVERYNATACVGCGRCIKNCPVNLDIRQVLADVRALD----------------
00477911   1/1  glicalcllacprda................ltkerledllvvidldrCigC------------------
00458591   1/1  .....................idldkCigCglCvevCPvgaiilelilelrk------------------
00483461   1/1  ........altkerledliveidldrCigCgaCvevCPvgiilvdliaelrrl-----------------
00520341   1/1  flgprcllcaacllacprgaitleerledg....lvvidldrCigCgaCvevC-----------------
00527791   1/1  ............................ieldgkvplrfridpdkCigCgaC------------------
00402101   1/1  flpgklrgkilltlaglgaaigrvdlsdigtypkpgpviep-----------------------------
00375131   1/1  ........gllllvglklvvvidlekCigCgaCvevCPvg------------------------------
00394531   1/1  .................glllllllvvidpdlCigCgaCv------------------------------
00396661   1/1  .............gaitldedgllivvidpdkCigCglCvevCPtg------------------------
00391421   1/1  ................dgivvidpdlcigcgaCvaaCPvg------------------------------
00383611   1/1  gkvlalflpvlCvhCgdpaCvavCPtgaillvlkdeedgi------------------------------
00471841   1/1  ..................lvvidlekCigCgaCvevCptg------------------------------
00384661   1/1  eerlkdfdevlllglgeeealrealrCihCgdppCvkvCPtgaiipeliglv------------------
00450371   1/1  ...............lllklvidlekCigCgaCvevCPvg------------------------------
00384701   1/1  .....................kvvidpdkCtgCglCvev-------------------------------
00356141   1/1  ......................llvidpdlCigclgkgee------------------------------
00448152   2/2  --------------------lkvvvdedkCigcglCvlvC------------------------------
00448151   1/2  ----------------------------------------------------------------------