[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO48707.1


[Show Plain Result]

## Summary of Sequence Search
   1::472
 131::472    2e-36 32.6% 0040956 00409561 1/1   A polymerase C-terminal region-like     
 131::385  1.3e-25 31.7% 0044734 00447341 1/1   A polymerase C-terminal region-like     
   9::130  2.6e-22 38.1% 0042031 00420311 1/1   otidyltransferase                       
   3::130  7.9e-21 36.1% 0044735 00447351 1/1   otidyltransferase                       
 131::394  3.8e-20 31.2% 0042030 00420301 1/1   A polymerase C-terminal region-like     
   9::130  3.9e-19 38.9% 0040957 00409571 1/1   otidyltransferase                       
   1::472


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTISMLSQQLSIQTYLVGGAVRDLFLNKIPVDLDFCVTAKVFALAQTLTQQYQGSLVTLDDQREMLRVV
00409561   1/1  ----------------------------------------------------------------------
00447341   1/1  ----------------------------------------------------------------------
00420311   1/1  --------kelgleaylvGGaVRDlllglppkDiDiavdatpeevakllakllikllvlvgkrfgtatvl
00447351   1/1  --lllellkelgleaylvGGavRDlllglpvkDlDivvdatpeevlellakalg.llvlvglefgtvtvv
00420301   1/1  ----------------------------------------------------------------------
00409571   1/1  --------kelgleaylvGGaVRDlllglppkDlDiavdatpeevlellak.....lllvgkefgtvtvl


                         -         -         *         -         -         -         -:140
query           TNSWHLDFSPLRDEILEKDLFARDFTLNAMALPVSMGINKYNWQNQIQDPTGGKGDLKKGLLRAASSSSI
00409561   1/1  ------------------------------------------------------------ilRtvgdPee
00447341   1/1  ------------------------------------------------------------ilRtvgdprF
00420311   1/1  lggllievatlrtevytsggrlpvvflgtleeDllrRDfTiNAlaldld.........ge----------
00447351   1/1  lggllievatlRtevytsggrlpvvflgtleeDllrRDftiNAlaldlne.....eldge----------
00420301   1/1  ------------------------------------------------------------ilrtvgdpee
00409571   1/1  lggllievatlrtelytsdgrlplvvlflgtleeDllrRDfTiNAlaldld.........----------


                         +         -         -         -         -         *         -:210
query           QQDPLRSLRGIRFAATYNLAIIPETMVLLRQGTRRIEQIAGERLWHELAILFKLPITSFWINYMDQELHF
00409561   1/1  rFrEDPLRiLRavRFaarlgftidpetlaairelagllakisaeRirvEllklLlgpnplralqll.rel
00447341   1/1  lEDPlRiLRavRFaarlgftiepetleaireavlagllakisaeRirvEllklLlspnplaalellr.el
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------
00420301   1/1  rFrEDpLRiLRavRFaarlgftgfsidpetlaaikelagllaklsaeRiwvEllKlLlgpnpsaalkll.
00409571   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WQYLLPGQLRMAQTKQNHYHVENVWRHCLRTYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSRCQVL
00409561   1/1  gllevlfpelaallg....lpeldrlihlllvdl....................................
00447341   1/1  gllevlfpela.......lllgvlqllehllkllntltllald.....................kpvspl
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------
00420301   1/1  relgllkvlfpeldalldlln.......................................tllrvaadls
00409571   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KLAALIHDVGKPDTAVIREDGRISFHGHAEAGVPYAEALATRLKLSRLERHYLVNLVLLHMLPLNLYNSG
00409561   1/1  llrlaallhdlgkpltpa......................llkrlklsnelrklvlllvelhllll....
00447341   1/1  llrlaallhdlgkeltpa......................llkrlklpkkeidlvlllvelhlrllk.rl
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------
00420301   1/1  ldpllrlaallhdlgkl........................eallkrlklsnkeiklvlllvalhlvlle
00409571   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DRSDLSVYRLFRSLENYILDVLILSLADVTATLTAGERISELEAYRTFILNLLGKFIVEKDRFHPVPYLS
00409561   1/1  ...lslsallrllrdlglllallllllladellalps.....rllelirellal......llrllkpkll
00447341   1/1  gkrlslsllydllrragrlll.lllllladirgvl-----------------------------------
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------
00420301   1/1  l.lellalrrllyrlgleilllllrllllelldalrllellafl--------------------------
00409571   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GAALLELGIPEGPEVGLILEKLCEEQVTGSITDTKTALLWVKTKLAGNNKDK------------------
00409561   1/1  ingkdllkllglkpgprlgealdelllavlegellneeeallewlkefledd------------------
00447341   1/1  ----------------------------------------------------------------------
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------
00420301   1/1  ----------------------------------------------------------------------
00409571   1/1  ----------------------------------------------------------------------