[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO48823.1


[Show Plain Result]

## Summary of Sequence Search
   1::396
   1::393 6.6e-142 46.1% 0051601 00516011 1/1   ependent transferases                   
   5::393 2.5e-141 46.6% 0042809 00428091 1/1   ependent transferases                   
   1::393 1.2e-137 46.3% 0045392 00453921 1/1   ependent transferases                   
   1::393 1.2e-131 48.3% 0051517 00515171 1/1   ependent transferases                   
   3::393 2.1e-131 47.5% 0043583 00435831 1/1   ependent transferases                   
  15::393 5.3e-128 49.2% 0052943 00529431 1/1   ependent transferases                   
  22::393   4e-126 49.9% 0052157 00521571 1/1   ependent transferases                   
   1::393 1.5e-113 42.9% 0048571 00485711 1/1   ependent transferases                   
   3::394   1e-100 38.3% 0050157 00501571 1/1   ependent transferases                   
  18::393  5.7e-92 35.7% 0044083 00440831 1/1   ependent transferases                   
   2::393  2.3e-91 35.3% 0046007 00460071 1/1   ependent transferases                   
  16::392  2.6e-85 33.8% 0035246 00352461 1/1   ependent transferases                   
   1::393  1.2e-80 32.0% 0046747 00467471 1/1   ependent transferases                   
  10::393  3.7e-79 32.3% 0050754 00507541 1/1   ependent transferases                   
  15::393  4.1e-71 32.7% 0050261 00502611 1/1   ependent transferases                   
  10::393  2.6e-70 34.3% 0052070 00520701 1/1   ependent transferases                   
  33::392  2.2e-61 29.9% 0046584 00465841 1/1   ependent transferases                   
  22::393  4.5e-60 31.0% 0044807 00448071 1/1   ependent transferases                   
  10::393  8.2e-56 27.3% 0041674 00416741 1/1   ependent transferases                   
  37::393  1.1e-55 30.7% 0042144 00421441 1/1   ependent transferases                   
  15::392  4.1e-54 30.1% 0049754 00497541 1/1   ependent transferases                   
   9::393  2.2e-52 28.7% 0035589 00355891 1/1   ependent transferases                   
  14::393  5.3e-52 28.3% 0053335 00533351 1/1   ependent transferases                   
   8::393  1.3e-48 27.8% 0050753 00507531 1/1   ependent transferases                   
   1::393  3.6e-46 26.2% 0046087 00460871 1/1   ependent transferases                   
  55::392  5.7e-45 28.2% 0048952 00489521 1/1   ependent transferases                   
  38::393  7.7e-45 25.9% 0046547 00465471 1/1   ependent transferases                   
  48::398  1.2e-44 28.3% 0048074 00480741 1/1   ependent transferases                   
   3::393  9.6e-44 23.3% 0045973 00459731 1/1   ependent transferases                   
  58::393  2.3e-43 29.1% 0041704 00417041 1/1   ependent transferases                   
  41::391  2.5e-43 24.3% 0049486 00494861 1/1   ependent transferases                   
  20::393  4.1e-42 25.8% 0036406 00364061 1/1   ependent transferases                   
  55::393  1.5e-41 26.8% 0046165 00461651 1/1   ependent transferases                   
  23::393  6.5e-41 25.7% 0040134 00401341 1/1   ependent transferases                   
  20::393  9.7e-39 26.0% 0050390 00503901 1/1   ependent transferases                   
  38::393  7.1e-37 25.6% 0050076 00500761 1/1   ependent transferases                   
  85::393  1.2e-35 30.1% 0048747 00487471 1/1   ependent transferases                   
  14::387  1.9e-30 21.8% 0045171 00451711 1/1   ependent transferases                   
   1::393  3.3e-29 23.5% 0049070 00490701 1/1   ependent transferases                   
  16::393  3.8e-29 25.1% 0051757 00517571 1/1   ependent transferases                   
  21::393  4.2e-29 26.0% 0047095 00470951 1/1   ependent transferases                   
  11::393    2e-28 22.9% 0050696 00506961 1/1   ependent transferases                   
  46::393  3.5e-27 23.4% 0047441 00474411 1/1   ependent transferases                   
   9::393  1.2e-26 23.9% 0035401 00354011 1/1   ependent transferases                   
  14::393  6.3e-26 25.6% 0051195 00511951 1/1   ependent transferases                   
   8::393  2.8e-25 22.2% 0046024 00460241 1/1   ependent transferases                   
  35::393  4.7e-25 28.0% 0047340 00473401 1/1   ependent transferases                   
   8::393  6.9e-25 22.8% 0039341 00393411 1/1   ependent transferases                   
  18::393  2.3e-23 24.3% 0047956 00479561 1/1   ependent transferases                   
  54::393  3.9e-23 24.9% 0052164 00521641 1/1   ependent transferases                   
  24::393  1.7e-22 24.0% 0036780 00367801 1/1   ependent transferases                   
  34::391  5.2e-22 28.5% 0038034 00380341 1/1   ependent transferases                   
  50::393  1.1e-21 23.7% 0046056 00460561 1/1   ependent transferases                   
  14::384  1.4e-21 21.2% 0042806 00428061 1/1   ependent transferases                   
   9::393  3.2e-21 23.8% 0038952 00389521 1/1   ependent transferases                   
  38::393  3.2e-21 22.4% 0037569 00375691 1/1   ependent transferases                   
  10::390  6.7e-21 18.5% 0035073 00350731 1/1   ependent transferases                   
  56::393  1.7e-20 22.6% 0044595 00445951 1/1   ependent transferases                   
  13::393  3.3e-20 21.7% 0046965 00469651 1/1   ependent transferases                   
  12::387  4.9e-20 19.4% 0045639 00456391 1/1   ependent transferases                   
   7::392  7.3e-20 19.3% 0046154 00461541 1/1   ependent transferases                   
  99::393  1.3e-19 23.4% 0047670 00476701 1/1   ependent transferases                   
  54::393  1.3e-18 21.0% 0049524 00495241 1/1   ependent transferases                   
  58::392    2e-18 26.7% 0035846 00358461 1/1   ependent transferases                   
  83::390    1e-17 28.2% 0052302 00523021 1/1   ependent transferases                   
 101::393  1.4e-17 23.0% 0042383 00423831 1/1   ependent transferases                   
  93::393  6.2e-17 24.8% 0052862 00528621 1/1   ependent transferases                   
  14::393    8e-17 22.9% 0051323 00513231 1/1   ependent transferases                   
  31::393  3.2e-16 22.1% 0050977 00509771 1/1   ependent transferases                   
  22::392    6e-16 20.7% 0041260 00412601 1/1   ependent transferases                   
  46::393  3.6e-15 27.8% 0040897 00408971 1/1   ependent transferases                   
  37::393  2.1e-14 26.0% 0035700 00357001 1/1   ependent transferases                   
  11::390  2.3e-14 20.4% 0045068 00450681 1/1   ependent transferases                   
 167::393    1e-11 23.4% 0050768 00507681 1/1   ependent transferases                   
  41::397  4.1e-11 24.8% 0047581 00475811 1/1   ependent transferases                   
  96::390  1.1e-10 20.8% 0045231 00452311 1/1   ependent transferases                   
  37::393    7e-10 22.3% 0051993 00519931 1/1   ependent transferases                   
 167::393  3.1e-09 21.0% 0046255 00462551 1/1   ependent transferases                   
  51::227  5.5e-09 29.5% 0052731 00527311 1/1   ependent transferases                   
 172::393    2e-08 22.7% 0046089 00460891 1/1   ependent transferases                   
  46::393    2e-06 27.5% 0045909 00459091 1/1   ependent transferases                   
  86::359  2.3e-06 23.0% 0046206 00462061 1/1   ependent transferases                   
  96::393  0.00064 21.0% 0040526 00405261 1/1   ependent transferases                   
 206::390  0.00094 22.0% 0044523 00445231 1/1   ependent transferases                   
   1::396


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT
00516011   1/1  msskelipgdlnsllrpftglldplvivraegaylydvdGneylDflsglgvlnlGhshpevveaikeql
00428091   1/1  ----mpkslelldraklllpggvnsyvrlplvieraegaylydvdgnrylDflsgigvlnlGhnhpevve
00453921   1/1  ptprskellerakklllggytslplvivraegaylydvdgnrylDflsgigvlnlGhnhpevvealkeql
00515171   1/1  llglpglvlllvralllygllplvivraeGaylydvdGneylDflsgigvlnlGhnhpevveaiaeqldk
00435831   1/1  --geldlpglvhpftralslygplplvivraeGaylydvdGnrylDflsgigvlnlGhnhpevveavaeq
00529431   1/1  --------------lklpkskelleellellpggvwhpvrafrlygplplvivraegaylydvdGneylD
00521571   1/1  ---------------------PlvivraegayltdvdGneylDflsglgvlnlGhahpevvealkeqldk
00485711   1/1  lelslpllltelpglsselllelllslllslyaplplvivraegaylydvdGnrylDflagigvvnlGhn
00501571   1/1  --leellelleslllsllyrlplvivraegayltdvdgrryldlssglpvnplGhsppevlealaealdr
00440831   1/1  -----------------lgslpepevgaqgepieliageeyldalvgaglinlghghpdvvidLlsdtlt
00460071   1/1  -dlldlldelleelkpeglyrplpivkgegarlidvdgreyldlssn..dylgghthpevveaaaealdk
00352461   1/1  ---------------rkfiaeplriksaegvyltdvdgreyldalsgynvlllghgdpeiDlltDsgtsa
00467471   1/1  lllllllllllldeelllllaeelyrlplvivrgegarlldvdgreyidl.asnnylglgh.hpavleaa
00507541   1/1  ---------ryippteeeiaemldaigvssldelfdpipleirrgeglplpdlserevldelsglasknl
00502611   1/1  --------------lsslplsllldlnlslssrlplvpldlirelladadgpdvidlgsgepdlglgp.p
00520701   1/1  ---------llldsleelldelipeglrrpfplllglplvlvralg.rlldvdgkeyldlasn..nylgl
00465841   1/1  --------------------------------efpllkgliyLdn......aalgllppavleamaeale
00448071   1/1  ---------------------plvllrairsllpdgdgviyldsagp......gplppavlealaeall.
00416741   1/1  ---------issrllnlppyvfd..eilelaalldadgpdvidlgvgepd...lppppavlealaeales
00421441   1/1  ------------------------------------kgviylds......aattpvppevlealaeales
00497541   1/1  --------------nmllserldrlppsailelleladgpdvidlgsgep..dlpp.ppavlealaeald
00355891   1/1  --------Msllssrllglkpslvleilelaalldadgkdvidlgagepd...lppppavlealaealds
00533351   1/1  -------------lfkrlgrlppspirgllalladldgkdvidlgvgiyldpepdlppppavlealaeal
00507531   1/1  -------lryigptegeiaemldalgvesldelfadvpaslrrkgllllpglselevlrhltdlagknyg
00460871   1/1  lklllepfrikvvepidptiaeeiekelkraggnlfllasenvyidlvsdalt...gsplpamyaalevg
00489521   1/1  ------------------------------------------------------mdlsklldrletlalh
00465471   1/1  -------------------------------------dliyldn......aaptplppevleamaealek
00480741   1/1  -----------------------------------------------iyldnagptplppavleallegl
00459731   1/1  --dkllsellelllaagllrldpeifsalrkelkr..gkdlinl..iasnnyl...ppavleallealtn
00417041   1/1  ---------------------------------------------------------Pevlealaevles
00494861   1/1  ----------------------------------------liyldsdattpp....ppavlealaealev
00364061   1/1  -------------------lnpalsetellrelldlasnnylglasvi...llgasttpvppavlealle
00461651   1/1  ------------------------------------------------------kldtllvhagrlldlg
00401341   1/1  ----------------------miplgsetrklldlisndylglaeiyllyasetpvppevlealleall
00503901   1/1  -------------------mllserldrlgpsvidellelaggpdvidlgigepd...lppppevleala
00500761   1/1  -------------------------------------gtehidflsd....nptgphpavlealaeallg
00487471   1/1  ----------------------------------------------------------------------
00451711   1/1  -------------lfsrlkalppdpilallalaaedpgpdvidlgvgvyldlepdlppppavlealaeal
00490701   1/1  lllelalaldelellealrklfpll...........kgliyLd......nasttpvppavleamlealee
00517571   1/1  ---------------elirketlrlrggin.....asenvlslnvlgaqt......spevieaaeealgg
00470951   1/1  --------------------llllllfpllllfpllkgliyLdnagptpl......ppevleamleal..
00506961   1/1  ----------pgsgtfvsdrlpdlppspirellelaggpdvidl..gigepdlgppplpaviealaeald
00474411   1/1  ---------------------------------------------iyldgpgptplppevlealarall.
00354011   1/1  --------Mssflklllssrlkslkpsvilellelaaelgangpdvidlgvgepdfgpplldllgltlpl
00511951   1/1  -------------llkrllkldtlairagfpllartggvivldlsagtp..pfp.vpeavlealaealag
00460241   1/1  -------mmdlssrlerlppsvirkllelaar..daggpdvidlgigep...dfppppavlealaealde
00473401   1/1  ----------------------------------ealgkdliyl....gsgapglgtppvvraaaeaaad
00393411   1/1  -------mllssrlrnlkpyvigpilelaaelgad..gpdvidlgvgepd...lppppavlealaeales
00479561   1/1  -----------------llppspilsllelaaelgaggkdvidlsvgep...dfppppavlealaealdg
00521641   1/1  -----------------------------------------------------lrllfpirelfpllmdl
00367801   1/1  -----------------------kdlsletlaihagsgpdvlnlvgppiyltnefvfelpeavlealaeg
00380341   1/1  ---------------------------------llalgtdvihlgsgepdylgpvappiylsstftfevl
00460561   1/1  -------------------------------------------------lelellRelfplldlnllldg
00428061   1/1  -------------lfsrlkalppspilklleaakrlggpdvidLgvgvyldlepdlppppavlealaeal
00389521   1/1  --------mssflstllsprlkslkpyvigellelaaelgaggpdvidlgigepdlgtpplelllltlvl
00375691   1/1  -------------------------------------gpdvinlgigdp...dfplppavlealalaeli
00350731   1/1  ---------lmlslfsrlealppdpilglleaakkdpgpdkinlgiGvyrd..eepdlpvppavkealae
00445951   1/1  -------------------------------------------------------lelssrldglpasli
00469651   1/1  ------------llskrlerlppspilelle..llaggpdvidlgvgepd...lppppavlealaealds
00456391   1/1  -----------mslfsrlkalppspilellelakelpgpdvinlgigvyrdeepdlptppavkealkeal
00461541   1/1  ------lselllllleglyevdpeiaeliekelkr.qgevllliase......nylspavlealgsaltn
00476701   1/1  ----------------------------------------------------------------------
00495241   1/1  -----------------------------------------------------lldlldirllfpalslf
00358461   1/1  ---------------------------------------------------------pplfdalvklaee
00523021   1/1  ----------------------------------------------------------------------
00423831   1/1  ----------------------------------------------------------------------
00528621   1/1  ----------------------------------------------------------------------
00513231   1/1  -------------klllskrldrlgpspirallllaagpdvidlgigepd...fppppavlealaealde
00509771   1/1  ------------------------------smdlserlsrlpsyireilelaaelgadgkdvidlgvgep
00412601   1/1  ---------------------ealellalgtdvihlgsnenp...lgavappiyqtptfvldalaeald.
00408971   1/1  ---------------------------------------------iplplgepdf.peevleaviealds
00357001   1/1  ------------------------------------kplvylfsaGPaplppevleamlkelldllgngl
00450681   1/1  ----------mlsllsnlkplppdpilglleaakadpgpdvinL..gigvyrdeepdlppppavkealae
00507681   1/1  ----------------------------------------------------------------------
00475811   1/1  ----------------------------------------midlrs....dtvtpptpevleamaea...
00452311   1/1  ----------------------------------------------------------------------
00519931   1/1  ------------------------------------kpliyLdg......pgptplpprvleamaryl..
00462551   1/1  ----------------------------------------------------------------------
00527311   1/1  --------------------------------------------------kkiplgspvfdeeeiaavle
00460891   1/1  ----------------------------------------------------------------------
00459091   1/1  ---------------------------------------------ksdliPdfptipeeeieavaealds
00462061   1/1  ----------------------------------------------------------------------
00405261   1/1  ----------------------------------------------------------------------
00445231   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG
00516011   1/1  dklghvsfgfttepavelaekLaellpaglekvfftnsGseAneaalklaray......tgrdkiisfeg
00428091   1/1  alaeqldrllhgsflggltelavelaerlaellplgldrvfftnsGseAneaalklarayalakgtp.rd
00453921   1/1  eklgytssggttelaealaellaellpldrvfftnsGseAnelalklarayylakgrlgtggdkilvfeg
00515171   1/1  llhvs..llhepavelaelllelaplgldkvffvnsGseAveaAlklarayalalgklgtgrtkiisfeg
00435831   1/1  ldkllhvsflglttepavelaellaellpgglldkvfftnsGseAveaalklarayt......grtkiis
00529431   1/1  flsglgvlnlGhahpevvealkeqldrlghvs..gttepavelaelLaellpglekvfftnsGseAneaa
00521571   1/1  lghvs..gttelavelaekLaellpglekvfftnsGseAneaalklaray......tgrdkiisfeggYh
00485711   1/1  hpevveaiadeeqldkllhvallsngaphepaeelaeklaelapegldkvfftnsgseaveaalklarqy
00501571   1/1  lgngssygptpgveelrealaellgadpaevlftnggteAlelalkaarll......gpgdevlvpepay
00440831   1/1  gpvltaqlaellpgdryyggnpgvdeLeerlaellgaehavftnsGteAnllalkallk........pgd
00460071   1/1  lglgsggsrllygtnplheeleealaellgaeaallfnsGteAnlaalkall.........gpgdivivd
00352461   1/1  asdaqlaallvgddayggdplafeleealaelfgldavlftnsGteAnelalkallayhrakgepgdtvi
00467471   1/1  iealdkygvgspgsrllygttplhdeleerlaellgaeaalvfnsGteAnlaalrallg.........pg
00507541   1/1  gvdplfyldgaattpvppavlealaealtagnpysphelsqgaleleeelaerlaellgadaaivftsgg
00502611   1/1  pavlealaealaelgpgllgygppeglpelrealaellaelfgaeaadpeeivltnggteAlelalral.
00520701   1/1  htppavleavlealekygvgsggsrlsygttelleeleealaellgaeevlltssGteAneaallalral
00465841   1/1  elagngssghrlsrgatelveelreklaellgadpeeviftssgtealnlalkalrl.......gpgdei
00448071   1/1  ..ghlsygategleelrealaellgadpayevvftsggtealeaallallk........pgdevlvsapg
00416741   1/1  g...llrygdptglpelreaiaellgrrrgvavdpeevvvtnggtealelalral.......lgpGd.ev
00421441   1/1  lllfgnphslghelsrgatplleelrellaellgadpaeivftsggtealelallalray...glkpgd.
00497541   1/1  ngllgyppsqglpelrealaellaellgadldpetevlltsggtealelalrallg........pgdevl
00355891   1/1  g...llgygpppglpelrealaellgarygvavdpeeivvtnggtealelalral.......lgpGd.ev
00533351   1/1  ddgagllgypdpaGlpelrealaellarlfgvevdpeeiaalltnggtealelalralrk.....lgpgd
00507531   1/1  ddliylglgalghkppavieallealegltaytpyqpelsqgalelleelqerlaellgadaanvvltdg
00460871   1/1  ddyygggptvdele..ervaelf....gaehavfthsGtaAnllallallk.......pGdevivpdhfl
00489521   1/1  agllpdvllatgadviplgqgepdvppaveealallgagatg.ygysrgtgplrealeerlaellgaeev
00465471   1/1  lygnpssghelgygatelleelrealaellgadpdeiiftsggtealnlallalrra...llkpgd.eil
00480741   1/1  g...hrsgygytelleelrellaellgadedaeevlltsggtealeaallall........kpgdevlvs
00459731   1/1  kygegypgsrlylgteavgplveeleerlaelfgaeadelgvavftssGtaAlllallallkp.......
00417041   1/1  g....wlygtgpgveeleealaellgaeeavftssgteAlnlallalg......lgpgd.evivpspthv
00494861   1/1  ..gdgnygsdpgleelrealaellgaeaaeivftsgGteAnllallalld........pgdevlvsepah
00364061   1/1  alenkygegypgsrlyqgtlsvdple..eeleerlaelfgaeaailltnsGtaAnlaallallk......
00461651   1/1  tggidliilstgeppfpvpeavlealaealasghl.ygygpgpgveelrealaellgaeevlltsggtea
00401341   1/1  nkygegnpgsryyggtlyvdplveeleerlaelfgaeaalvftnsGtaAnlaallallk........pgd
00503901   1/1  ealdsgal.llrypdpaglpelreaiaellgrrygvdvdpeeeilvtnGgtealelalralld.......
00500761   1/1  ..ddlgygadplveeleeklaellgaeaavlftsgGteAnllallaare........pgdevivsataHi
00487471   1/1  --------------deleealaellgaeealvtssgteAlelallal.......lkpGD.evivpsptyg
00451711   1/1  ed.gltlgYgppeglpelreaiaellarygvgvdpeevvvtnGgtealalalrll.....allnpg.dev
00490701   1/1  lyangpsghelgrgalelveelrerlaellgadpaeivftssgtaalnaallalgaallsplkpgd.evl
00517571   1/1  ..ygysrggdplreeleellaelfgaeaalvtssgtaAillallallk........pgdeilvsrglyhg
00470951   1/1  .ihhlgpeftelveearellaellgadpgeevvftgggtealeaallgl.......lkpgd.kvlvssng
00506961   1/1  sggalllgygdpaglpelreaiaeylgrrrgvdvdpeqilvtnGatealelalral.......lgpG.de
00474411   1/1  ..shrsyeftagleelrealaellgadpdvvlltgggtealeaallal.......lgpgd.kvlvpapgy
00354011   1/1  pavlealaealaeg...llgYpdpaGlpelreaiaellarrygllvgvdpeeilvtnGatealelalral
00511951   1/1  ..grygyggnpgveeleealaellgaeealvtsggtaaillallal.......lkpG.Devl.vpapayg
00460241   1/1  lldgagllgYpdpqGlpelreaiaellgrrygvdvdpallkledeivvtnGgtealllalralld.....
00473401   1/1  lfanplsggeysrganptleeleealaellgaeealltsggtaailaal.al.......lkpGd.evi.v
00393411   1/1  g..llgygpspglpelrealaellgarygvavdpeeivvtnggtealllallal.......lgpGd.evl
00479561   1/1  llrypdpglpelreaiaall..gvdpeeilvtnGatealalllral..........pgdevlvptptYpg
00521641   1/1  iyldnagptplppevleamleal...ishrspeftelveearellaellgadpyeeivftgggtealeaa
00367801   1/1  ltg..ytysrggnplrealeeklaelegaeealvtssgtaAieaallal.......lkpG.devl.vpep
00380341   1/1  eaviealagggtgydysrgpnptvealeealaellg....aeaalvtssgtaAillallal.......lg
00460561   1/1  liyldnaattplppavleamaealeeyygnphsgghelgrgalelleelrerlaellgadspdevvftsg
00428061   1/1  eegllhgYpppaGlpelreaiaelllrrygvgldpervaivvtnGgtealalalrll.....allnpg.d
00389521   1/1  pavlealaealdgllgYpdsaglpelreaiaeylarrygglvgvdpeeilvtnGatealelllral....
00375691   1/1  dldanenplgpslaaldagllrypdpglpelreaiaell.gvdpeeilvtnGatealalllral......
00350731   1/1  aledlegllgYlpiaGlpelreaiakllfgryglaldperiatvvtnGgtealslaaeflkrflrallnp
00445951   1/1  rellelaggpdvidlgvgepdlpppeavlealaealggllgypdppglpelreaiaall..gvdpeeivv
00469651   1/1  g...llgygppaglpelreaiaeyllrrrgvgvdpeteilvtnGatealalalral.......lgpGd.e
00456391   1/1  eegltlgYlpiaGlpelreaiaelllrrygldldpdrivlvqtlsttGatealalllralln.....pgd
00461541   1/1  kyaegypgsryyggteyvdpleeeleerlaelfgaehallfanvqpssGtaAnlaallallk........
00476701   1/1  ----------------------------gvftsGgteAnllallaardralprrkaeglaalgleglpgl
00495241   1/1  algkdliyldnaattplppevleamleallellgnphssgyslsrganplveelrerlakllgaddpeei
00358461   1/1  gpysfhvpghkggvlnfasnlylgfpdfpgpnealealgaalggldllygpsggileleealaelfgadd
00523021   1/1  ------------mkfetlllhagldpdpltgavnppiylsstpvfdtpeeiaaafealesgyiysriggp
00423831   1/1  ------------------------------ftsGgteanllallaarnralpkrkaaglgipgpeilvs.
00528621   1/1  ----------------------ladrlknlppsitlallalalellaggkdvidlsvgepdfppppavle
00513231   1/1  ggalllgYpdpaGlpelreaiaeylarrygvgvdpeeeilvtnGatealalllral.......ldpG.de
00509771   1/1  dlldfppppavlealaealddgllgYpdpaGlpelreaiaellkrrrgvgvdpeqilvtnGatealalll
00412601   1/1  .ggrygrgpnpgleeleealaellgaeevlltsggtaaif.allal.......lgpGd.evlvpaplygs
00408971   1/1  ggytrgpgvaeleealaell....gaehavatnsgtaAlllallal......glgpGD.eVivpaltfvs
00357001   1/1  svleishrskefteileearellaellgapddyev..................vlltgggtaaleaalln
00450681   1/1  aledgllllrYppiaGlpelreaiaelllgeygvgldpervaivvtnGatealllaarflalln.....p
00507681   1/1  ----------------------------------------------------------------------
00475811   1/1  .nvgddvygedptvneleerlaellgkeaavfvpsGtmanllal........aallqpgdevlcdelaHi
00452311   1/1  -------------------------pdriatvvtnGatealslalralkrflkgklnpg.devlvpdpty
00519931   1/1  .ihhrspeftelleearellaellgakndlkyteiiftgsgtealeaalanlllll.....kpgdkvlvs
00462551   1/1  ----------------------------------------------------------------------
00527311   1/1  ald.sgvytlgptvdelEealaallgakyavavssGtaAlllallall.....glgpdgkeVivpsltfv
00460891   1/1  ----------------------------------------------------------------------
00459091   1/1  gilsytlgpgvkelEeaiaell....gakyalavssGtaAlllallal......glgpgd.eVivpsptf
00462061   1/1  ---------------rqvggivlilsenappfyvpeavldalteayaegfagyrggygysrlrnptaeal
00405261   1/1  -------------------------penivvtaGatealslallalldnltnlllkpgdevvvpdptYpg
00445231   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVK
00516011   1/1  gYHGrtlgalsltgs.syiegfgpllagvvhvphpdtyrlpyndeleelgllllealeelleelgpddia
00428091   1/1  kilvfegaYHGrtlgalsltgsklyhaslfgpllpgvvgvpapylyrteelgyndldaleallaehgeki
00453921   1/1  gYHGrtlgalsltgspsylggfgplgagvvvvpypdlealeaaiepdtvaavivepvqgegGvivpppef
00515171   1/1  gYHGrtlgalsltgsglyrlgfgpllpgvvhvpfpdllllllalggddiaAvivEPvqgegGvivpppgf
00435831   1/1  fegayhGrtlgalsltgsgllrapfgpllpgvvhvpapllyrlllleyndlealealieellgpdtiaav
00529431   1/1  lklaray......tgrdkiisfeggYHGrtlgalsltgsgayrlgfaplpgvprlpapdtyrvpyndlea
00521571   1/1  GrtlgalsltgspadrlgfapllggvrlpapdtyrvpyndlealealleelgddiaavivepvqgegGvi
00485711   1/1  glglggsrlvlgtlelheeleelladtgrekilvfsggyhgntlallaltgpgdevlvpdplypgylhaa
00501571   1/1  HgstlaalrlagakvvevtfvpldpdglllpypdlealeaaitpktaavileppqnptGvvlpspeylee
00440831   1/1  evivpdlayggtteagllagakpv.............fvdvdedgnldlealekaitevgaektkaiile
00460071   1/1  eltHgstldglrlsg............akvvfvphndlealeaalaeatprtkavvvesvfsptGdiap.
00352461   1/1  is..ngyhgttlehvslagakvvrvpfdpaldealllpedgnldledLeklikehgadniaavileptqn
00467471   1/1  divlvdelnHgstldglrlsg............aevvfvphnDldaleallkelreegpkpkliivegvf
00507541   1/1  teAnllallaarryhrargelgpgdevlvpdpaHgsnlaaarllGae............vvevpvdedgr
00502611   1/1  ......lgpG.devlvpdptyhgylaaarllGa.............evvfvpldedgldlealeaaltea
00520701   1/1  ......gpgdevlvdelahhsildgarllgaevvv.............vphndldaleaalteagpprtk
00465841   1/1  lvsalehpsvleaarllaerlgaevvfvpldeevdgll..dlealeaaltpktklvvlehvsnetGvilp
00448071   1/1  hpsvl......laeaaerlGa.....evvvvpvdedglldlealeaaleehrtklvilehvnnptGvvlp
00416741   1/1  lvpsptypgylaaarlaGaevvfvpldedngfgl.........dlealeaaitpktkavilenpnNPtGv
00421441   1/1  evlvsslehgsvlraae.llerlGae.........vvlvpvdpdgrldlealeaaidpntklvvlehpnn
00497541   1/1  vpdptypg.ylaaarllG............aevvfvpldedgflldlealeaaltektkavileppnnpt
00355891   1/1  ivpsptypgylaaarll........GaevvfvpldpdgtfgldlealeaaitprtkaiilenpnNPtGtv
00533351   1/1  .evivpsptypgylaaarlaGakvvfvpldedgtfgi.............dlealeaaiteapktkaiil
00507531   1/1  gtaaleaallalr.......ltpgdevlvpdgahpsnlaalqtl.........aallGaevvvvplddle
00460871   1/1  ahggflet....ggaallsgatpv.....fvdydlvdpdtgnidlekleaaikevgapktkliilenpvn
00489521   1/1  lltsggteAlelallall........kpGdevlvpdptyps.tlaaarlla........kvvgvpvdedg
00465471   1/1  vsspehps.............vlkaaellerlgaevvevpvdedgrldlealeaaldedtklvvlthpnn
00480741   1/1  dpahgstl...........yakaakllGaevvfvpldedglidlealeaaitegpktklvvlehpsnptG
00459731   1/1  .gdevlvpslahggstlaaarllGa...gvnfsgllfkvvfvdvddetgnidledleaaitepktkaiiv
00417041   1/1  atlaailll........Gakpvf.....vdvdetgnidlealeaaieehtpktkaii...vvnptGvvad
00494861   1/1  psvleag..aaellGak..vvpvp.dedgkl..dledleaaitedtahgllpklvvltnpnnptGtvysl
00364061   1/1  ...pgdevlvddlahgstlagarlanasglGae............vvfvpvdedglidledleaalkekt
00461651   1/1  lelallallk.......pGd.evlvpdptypsylaaarll.aevvf.............vpldedggldl
00401341   1/1  evlvpslahgs.tlaaarlagakrl.......gievvfvdvdpetglidlddleaairprtklivleh.s
00503901   1/1  .pGdevlvpdptYpgylaaarlaGakpvfvpldedgllplllglendflldlealeaaitprtkaiilpn
00500761   1/1  svleagailglggak............vvlvpvdedgkldleaLeaairedtahvhgtrpvlveitgnte
00487471   1/1  a.tleai........rllakpvfvdvdedggndlealeaaitpktkaiilehpsnptGtvld....leea
00451711   1/1  lvpdptypgylaaarlagaevvpvpldeengfgl.........dlealeaalaeatektkllllnnpnNP
00490701   1/1  vsalehgsvlaalallaerlGaevvfvdv.........idlealeaaltpdtklvllthvsnptGvlld.
00517571   1/1  slihglklsgakvvfvd..............dledlekaikektklvvl..psnptgrilsle.dlkeia
00470951   1/1  hfs...........vllaeiaerlGaevvvvpvdegglvdlealeealkepktklvalthvenstGvinp
00506961   1/1  vlvpsptYpaylaaarlagak.............vvpvpldefgldlealeaalteakekgpktkaiilv
00474411   1/1  fsvr......laelaerlgaevvvvpvdpgglvdpeale...tpdtklvllthpenptGvvld....laa
00354011   1/1  .......ldpG.devlvpdptYpgylaaarlatgaevvpvpl.deeggfll....dlealeaalteapeg
00511951   1/1  sylallrlllkrfGaevvfvdld............dlealeaaitpktklvvlespsnptgtvld....l
00460241   1/1  ...pGdevlvpdptYpg.............ylaaaelaGaevvpvpldeeggflldldaleaaitpktkl
00473401   1/1  sdpaygstlallrllleraGaevvfvdld............dlealeaaitprtklvllespsnptGtvl
00393411   1/1  vpdptypa.ylaalrlaGaevvfvpldpdgg.....flldpealeaaitpktklvllvnpnNptGtvldl
00479561   1/1  ylaaarlagae.............vvpvpldndfgldldaleaaiktpktkllllcnpnNPtGavlsr.e
00521641   1/1  llnl.......lkpgd.kvlvssnghfs...........vlaaeaaerlGaevvvvpvdpgglvdleale
00367801   1/1  lygstlellralakllGaevvfvdld............dledleaaitpktklvllespsnptgtvld..
00380341   1/1  pGD.evl.vpdplygstielfglalrlaGaevvfvdld............dlealeaaitprtklvvles
00460561   1/1  gtealnlallalaaa...hlkpgd.evlvsalehpsnlaalrllaerlGa.........evvvvpvdpdg
00428061   1/1  evlvpdptypnylaiarlaGa.............evvevpldeendfgldldaleaalteapektkllll
00389521   1/1  ...ldpG.devlvpdptYpgylaaarlatgaevvpvpldeeggfll..........dlealeealtealk
00375691   1/1  .lnpgdelvlvpdptYpg.............ylaaarlagaevvpvpldedfgldlealeaal.pktklv
00350731   1/1  g.devlvpdptypnylaiarlagae............nvvevplddentfgldldallaalesatektkl
00445951   1/1  tsGatealnlalral.......lgpG.devlvpsptypaylaalrll........Gakvvfvpldleedg
00469651   1/1  vlvpsptypayaaaarlaGak..........vvfvpldeeggflldlealeaaitpktkaillpnpnNPt
00456391   1/1  evlipdptypnylaaaklagak..........vvpvpldeengfgldlealeaaleeatektkllllnnp
00461541   1/1  pgdevltpslehgGhlthgstfdatalalsglgaepvfydvdpetglidpdaleealrertpaiivagvs
00476701   1/1  vilvsdpaHys.............vekaarllGlgvrlvpvdengrmdleaLeeaieedtaaglipaavv
00495241   1/1  vftsggtealnlallala....laglkpGdevivsapehpstlaawrllaerl....Gaev.....vfvd
00358461   1/1  aifvtnGtseanlavilallg........pGDevlvdrpsHksilnggarlaGakpvy...lptdrngfg
00523021   1/1  tveeleealaellgaeealltssgtaAlllallal.......lkpGD.evivpaptygs.taeairlllk
00423831   1/1  paHysvlkaarll........gie.....vrlvpvdendgrmdlealeaaidentalvvatagttptGai
00528621   1/1  alaealdgllgypppaglpelreaiaeylerrygvgvdpenilvtnGatealflalral.......lnpG
00513231   1/1  vlvpsptYpgylaalr.lagakvvpvpldelltggllseggflldlealeaaitpktkliilnnpnNPtG
00509771   1/1  ral.......ldpg.devlvpdptYpgylaaaelagakvvpvplde..eggfll....dlealeaaltpk
00412601   1/1  ylalarlalkrlGaevvfvd..............ldledleaaitektklvflespnNptgtvld....l
00408971   1/1  tanavlla........Gakpvfvdvdpdtfnidpealeaaitprtkaiv..pvnptGavad.....leai
00357001   1/1  l.......lgpgdkvlvlvtghfgnraadla.......krlgaevvvvpvdegglldleeleaalidpdt
00450681   1/1  g.devlvpdptypnylaiaklagaevvpvplddengfgl......dleallaalteapektkllllnnpn
00507681   1/1  --------------------------pvpldgfgldlealeaalkeakeatpktkliylvpnpnNPtGav
00475811   1/1  .....lldeagaleflsgaklvplpgedgk.ldpedleaairdddvhfprtrlvslentqntegGtvyp.
00452311   1/1  pnylaiaelagaenvvevplddendfgl......dldallaalekatpktkllllnnpnNPtGtvlt.pe
00519931   1/1  anghfsvrwaeiaerlga...........evtvllpvdwggpvdleeieealdepdtklvalvhvetstG
00462551   1/1  --------------------------flflldlleleaaitpktkllllcnPnNPtGav.lsreeleala
00527311   1/1  atanailla........gakpvfvdvdpdtnidpedleaaitpktkaii..pvnllGqvad.....ldei
00460891   1/1  -------------------------------dlealeaaitepktkllllcnpnNPtGavlsre.eleal
00459091   1/1  vatanailla........gakpvfvdvdpdtfnidpedleaaitpktkaii..pvnptGnvad.....ld
00462061   1/1  eralaalegaeevvltssgtaAialallal.......lkpG.Devlvsdplyggtltllrllgarggivv
00405261   1/1  ylrlakllgakvvfvdl..............dlealekaitpktklvflesPnNPtgtvld.........
00445231   1/1  -----------------------------------------------------------------reele


                         -         -         -         +         -         -         -:280
query           QLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHAS
00516011   1/1  avivEpvqgegGvivpppgylkelrelcdkygillivDEvqtGfgrtgklfafehfgvvpDivtlgKalg
00428091   1/1  aavivepvvqgegGvivpppeflkalrelcdkhgilliaDEvqtgfgrtgklfafehagvtpdivtlsKa
00453921   1/1  lkalrelcrkhgillivDEvqtgfgrtgklfafehlgvtpdivtlsKalgggglplgavlgseeiadalg
00515171   1/1  lkglrelcdkhgillifDEVqtGfgRtgklfafehygvvPDivtlaKglggGylPlgavlgskeimdafg
00435831   1/1  ivePvqgnggvivpppgflkalrelcdehgilliaDEvqtgfgrtgklfafehagvvPDivtlaKglggG
00529431   1/1  leallaehgdeiaavivepvqgegGvivpppgflealrelcdehgallivDEvqtGfgrtg.lfafehfg
00521571   1/1  ppppgylkalrelcdkygallivDEvqtgf.rtgklfafehfgvvpdivtlgKalggGlplgavlgseei
00485711   1/1  llagarvvfvpldvdedghldlealeaaleeldaggdrtaavilepvqnptGvvlppeeylkelrelark
00501571   1/1  laelarehgallivDeayagfgrtglpfapealgvdivigslsKalggglglGavlgsdeladalrplrr
00440831   1/1  ppanptGvlplspadlkaireiadkhgillivDeahaaglaytgklfgseyagvaigelvpdlfggadiv
00460071   1/1  ...laeiaelarkhgallivDeahaggvlgrtgrgl.lellglgadivvgtlsKalGg..rgGavlgsee
00352461   1/1  ptGgqvpsleylkelreiakkhgillilDearlaenayfgfgrtgslfaleiagivpdiltladvvtfsl
00467471   1/1  smtGdiap....lkelreladkygallivDeahaggvlgatGrgl.lehlgvlpdadivtgtlsKalggg
00507541   1/1  idlealeaaidertaavvltnpnnptGviep....leeiaelahehgallivDeayagglglgvdpgdl.
00502611   1/1  gadgllpktkavilepnpnnptGv.vlppeelealaelarehgallivDeayagfvytgkpagslaalde
00520701   1/1  lvvlesvnnptGtiap....lkeiaeladeygallivDeahaggvlgrtgrgla.ehlgvepdadivvgt
00465841   1/1  ....lkeiaelakehnGdlsallivDaaq.avgalg....ldlaglgvDivvfslhKalggpggiGalyv
00448071   1/1  ....leeiaelarehgallivDeaqalgalpgdldal...gvdivvfslhKalggglglGallvseelle
00416741   1/1  .vldleelealaelakkhglllivDeayaglvydgkplsalalldalgrvivlgSfsKalglpGlrlGyl
00421441   1/1  ptGvvlp....leeiaelahehgallivDaaqaagalpldlgel.....gaDivvfsahKyl.ggpglGa
00497541   1/1  Gvvlple.eleelaelarehgillivDeayagfvytgklpvslaellgvagadivvgSfsKalglpGlrl
00355891   1/1  ldle.elealaelarehglllivDeayaglvydgklpgslaeldgvdivlgsfsKalglpGlrlGylvad
00533351   1/1  epnpnnPtGvvlpleeleelaelakkhgillivDeayagfaydlggkgpsllelldlgpdvivlgSfsKa
00507531   1/1  aleaaldedtaavllehp.nptGvvld....laalaelahaaGallivDaaqaalgllvdpgal...gad
00460871   1/1  paGgsvysladlkaireiAdkyglllivDaAraagalyaggvtgspyafrsigeivdeifgyadivsfsl
00489521   1/1  gldlealeaaietpktkavilespnnptGvvld....leeiaelakehgallivDeayaggal.gdplel
00465471   1/1  ptGvilp....leeiaelakehgpdallivDaaqaagvlpldldelg.....vDfvvfsghKal.gppgi
00480741   1/1  vvld....leeiaelakehgallivDaayaagalpldplel.....gaDivvfslhKalggppgvGallv
00459731   1/1  ..vasnpGviad.....leeiaeiakkhgallivDaAh.algavgldvlpgplg.gaDivsfslhKtlgg
00417041   1/1  ....leeiaeiakehgillieDaaqalgalygglkaggfggadifsfslsKtlggg.ggGalltndeela
00494861   1/1  e.pleeiaalakehglllhvDgayaggalpglgvsvaeldgaegadvvsfslhKtlggpg.gGallvrde
00364061   1/1  klivles.snptGvvad....lkeiaelaheygallivDeahaagllgldgrppgelgaDivtgslhKtl
00461651   1/1  ealeaaitpktklvvlenpnnptGvvld....leeiaelakelghgallivDeayalgvl.gdplel...
00401341   1/1  nptGrvad....leeiaelaheygallivDeAhaagllalglhglple..gadivvgslhKtlgGp.rgG
00503901   1/1  pnNPtG.avlsreelealaelarkhglllieDeayaelvydgkpfpslasldgeygrvivlgSfsKtlgl
00500761   1/1  tGtvysldeleeiaelcrehglllhvDgArlgnalgalgvdlaeldgaegaDsvsfslhKglgapgggal
00487471   1/1  iaelakkhgillivDeayalgvl.gdp...lelgadivvfSfsKalgGptGlrgGalvgndelieallkl
00451711   1/1  tGavlsre.eleelaelakehglllivDeayaglvyggeedapsllaladalprvivlgSfsKtfglpGl
00490701   1/1  ...ieaiaalahehGallivDaaq.aagll..pldvgelgaDfvvfsghKtlgggppglGflyvreelle
00517571   1/1  eiakeygallivDeahgaglvggpllpsplelgaDivvgSlhKtlgGp.rgGyiagkkelieklrkvfpg
00470951   1/1  ....leeiaelahehgallivDavqslgal...pidvdelgvDflvssshKglggppGlGflyvsekale
00506961   1/1  pnpnNPtGavlsle.eleallelarkhdllvieDeayaelvydgkpfpslasldepdrvivlgSfsKtll
00474411   1/1  iaalarehgpdallvvDaaqslgalp...ldldelgvdvvvgslqKalggppglGflavspellerlep.
00354011   1/1  glktklvllpnpnNPtGtvlsre.eleellelarehglllivDeayaelvfdgapfpslaslllelglrl
00511951   1/1  eaiaelahehgallivDeayaag.vlgd...plelgadivvgslsKalggpgdlrgGylvgseeliealr
00460241   1/1  ivlpnpnNPtG.tvlsreeleelaelarehgillivDeayaelvydgepkdalppslasldglgrvivlg
00473401   1/1  d....leeiaelahehgalvivDeayaag.llgd...plelgadivvgslsKyl.gghgdlraGylagre
00393411   1/1  e.elealaelarehgllvivDeayaelaydgrpapsllsldpdalgrdivvfSfsKtlglpglrvGylva
00479561   1/1  elealaelarehgillivDeayadlvydgasfvslasll.dnvivlrSlsKafglaGlRlGylvappeel
00521641   1/1  aaleepdtklvalthvetstGvllp....leeiaelahehgallvvDavqslgalpidvdelg.....vD
00367801   1/1  ..leeiaelahenhgalvivDeayaagvlld....plelgadivvgslsKylggpgdlrgGyvagseeli
00380341   1/1  psnptgtvad....leaiaelahkhgalvivDeay.atgvlgd...plalgadivvgslsKalggpgdrl
00460561   1/1  lldlealeaaldprtklvalthvsnvtGvilp....laeiaalahehgalvlvDaaq.aagalpl..dlg
00428061   1/1  nnpnNPtGtvlsle.elkalaelakehgillvvDeaYagfafggeedapsilelagagpnvivlgSfsKt
00389521   1/1  egpktkalllpnpnNPtG.tvlsleelealaelarkhgillivDeayaelvfdgppfpslasldgallll
00375691   1/1  vlpnpnNPtGtvlsle.eleelaela.khgalvivDeayaelvyggpllslldllgrvivlgslsKtlgl
00350731   1/1  lllnsphNPtGtvl.tpeelkelaelakehgllvivDeaYqgfayggleedatsirslvelgenvivlnS
00445951   1/1  flldlealeaaitprtkaillvnpnNPtGavldle.elealaelarehgllvieDeayaelvydgpfpsl
00469651   1/1  Gavl.sleeleelaelarehgllvieDeayaelvydgkpapslasldglldrvivlgSfsKtfglpGlRl
00456391   1/1  hNPtGavl.sreelkelaelakehdlllisDeaYqgfvydgleedavsiaslaelgdrvivlnsfSKtfg
00461541   1/1  aygrlad.....lkelreiadevgallivDaAhaaGlvaagvlpspfggadivtftthKtlrGp.rgGai
00476701   1/1  atagttptGai....dpleeiaeicrehgiwlhvDaAygggalpfpeyrllldgiegaDsitfslhKwlg
00495241   1/1  vdedglidlealeaaitpkTklvalvhpsnptGvvlp....leeiaelahehgalvivDaaqaagalpid
00358461   1/1  giggirfkhldpealeealtelkpeglrplpktkavvltnpnptGtvyp.....leeiaelakkhglyll
00523021   1/1  rlGakpvfvdlde...........dlealeaaitpktkaiilehpsnptGtvad....leaiaelakkhg
00423831   1/1  ....ddieeiaelaeeygletglgiwlhvDaAyggfllpfleklrpldfglpgvdsisvsghKyglaplg
00528621   1/1  .DevlvpdptYpg.ylaaarlagakvvpvpld..edg....flldlealeaaitpktklillpnpnNPtG
00513231   1/1  tv.lsreelealaelakkhglllisDeayaelvydgapftsllslpdaldrvivlrSfSKtfglpGlRvG
00509771   1/1  tklvlltnP.nNPtGtvl.sleeleallelarkhgllvisDeayaelvydgpfpslasldgydrvivlgs
00412601   1/1  eeiaelakkhllnpgalvvvDeayatpvlgd....plelgadivvhSlsKalggagdlriGyvvgndeli
00408971   1/1  aelarehgllvivDaahalgalyggrh.pgslgadivsfsasKtltggg.gGavvtndeelaerlrklrn
00357001   1/1  klvalthnetstGvlnpl.........lakkhgallivDavssilarp...idvdklgv..dyasaqKnl
00450681   1/1  NPtGtvl.sreelkelaelakehglllivDeaYqgfaydgldedalavrsflelldagdnvivlrSfSKt
00507681   1/1  lsleeleallelarkhdllvieDeayaelvydgapfpslasl....dapdrvivlgsfSKtllpGlRlGy
00475811   1/1  leeleeiaelArehglllhlDGARlanalvalgvslaelaglvdsvsvglsKgl..gapvGavlvgdk.d
00452311   1/1  elkelaelakehgllvivDeaYqgfayggldedapsllalleagenvivlrSfSKafglaGlRvGylvap
00519931   1/1  vlnd....ikeiaelakelshgallvvDavq...slgalpidvdelgvDflvassqKgllgppGlgflyv
00462551   1/1  elarkhgllvisDEiYadlvfdgepppsllldaydrvivlrslSKtfglaGlRlGylvapnelirallkl
00527311   1/1  aeiakkhglllieDaaq-----------------------------------------------------
00460891   1/1  aelarkhdllvisDeaYadlvfdgapfpslasllpdlydrvivlrslSKtfglpGlRlGylvapnpelie
00459091   1/1  aiaeiakkhgllvieDaayalgalykgkkvgsf.....gdivvfSfsktKnltg.gegGaivtndkelae
00462061   1/1  tfvdg.........ldlealeaaitektkliflespsNptgtvld....laaiaelAhevgallvvDnty
00405261   1/1  ..akehgilvivDeaYaepvydplp...laydndivlrSfSKyfglaGlrlGwavvpdeelidklrklkl
00445231   1/1  alae.hgllvvsDeaYadlvydsalllleaydnlivlrsfSKafglaGlRlGylianpeliealrklrsp


                         -         *         -         -         -         -         +:350
query           TFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRGLGLMIGLELGIEGKDI
00516011   1/1  gGlPlgavlgskeimdalrpgsflhggTfsgnplacaaalaaleileeedllerlaelgeylregleell
00428091   1/1  lgggglplgavlgseeiadalapgalgaflhggtfggnplacaaalaalelleeedllerlaelgarlre
00453921   1/1  pllhggtfggnplacaaalaalelleeeellerlrelgdyllegleell..lplvgdvrglGlmlgielv
00515171   1/1  pglhggTfggnplacaaalavleileeedllenvaelgeyllegleelaakhplvgdvrglglmlgielv
00435831   1/1  lPlgavlgsaeimdalapllhggtfggnplacaaalaaldvleeegllerlaalgeylrdgllellakhp
00529431   1/1  vtpdivtlgKalggGlplgavlgsaeimdalapggpglhggtfsgnplacaaalaalelleeedllerla
00521571   1/1  adalrplgpglhgstfsgnplacaaalaalelleeegllerlaelgaylregleellakhplvgdvrglG
00485711   1/1  hgillivDeayagfgrtgkpfalellgvddrpdivtlshKalg.G...Gav.gseelidalrpl.hggtf
00501571   1/1  gltfggnplaaaaalaalelleeeelrerlreladylaegLael..glelvgpvrggglflfvelpggda
00440831   1/1  sfslsKtlggp.rgGailtndeeladklrklrfpgegfplgggyrgspiaaaaallalellee..llerr
00460071   1/1  lidalrplarggtfsgslnplaaaaalaalelleeegleelrerlaelaarlregLael....g.levvp
00352461   1/1  sKgggapgGgvlatgdkelieklrrlrkvlgegffthgglagagplalaaglaelel...edllarvien
00467471   1/1  .rgGailgskelidklrslarpgifstslnplaaaaalaalelleegeelrerlrenaeylregLeel..
00507541   1/1  ..g..aDivtlslhKtlggpkgggGprlGallvrdelaealplrlggggergfvltldreqairrglagt
00502611   1/1  lgvdivlgslsKtlggglrlGalvgdeeliealrklrhggtftgnplaqaaalaaledlaleehleelra
00520701   1/1  lhKal..GprgGalagseelidalrplarggtfsgtlnplaaaaalaalellgeegleelrerlralaay
00465841   1/1  rkelldrlrpllhgggslilvvrfdsltlqelglrfefgtppvaaaaalgaalelleeeglleairerlr
00448071   1/1  rlrpllsggtslyldlllllkyeqerrfragtpnplaaaallaalellleeglealrarlaeladylaeg
00416741   1/1  vadpeliealrklrsggtfgpsplaqaaaaaaled.eleelrerlrerrdllaeaLeel..glevvgpsg
00421441   1/1  llvrdellerlrpllhggglekrfeagtpnplaiaallaalellgeglealraralelaeylregleel.
00497541   1/1  GalvgdeelidalrklrrggtftlsplaqaaalaaledleehleelrerlrelrdrlaeaLeel..glev
00355891   1/1  peliealrklrsggtlgpsplaqaaaaaaledlelleehleelrerlrerrdrlaealaelg.levvgpg
00533351   1/1  lglpGlrvGalvgpdeellllalliealrklrrpgtgspsplaqaaaaaaledlelrghwlaeleelrer
00507531   1/1  ivvgslhKllgPhglggpgaGalavreellralpgrlvgvtgdadgkralrlalqtreqhirrekgtsni
00460871   1/1  sKglggp.rgGaivtndeelakkarklrfpgegfllgggprqhgiaaaaallalaelee..ylerrhena
00489521   1/1  ...gadivvgslsKalggpaGlrgGalvgndeliealrklrsggggtlsplaaaallaale..gleerre
00465471   1/1  Galyvrkell..lrpllvgggqerrfeagtpnvlaiaalaaalellgegleairarlleladyllegLke
00480741   1/1  rkelieklrpllpgglldlvlalkylgavlgfftgtpnilgiaalaaalellgeeggleeilerlrelad
00459731   1/1  p.pGGallvndelieklrplrvgglfdlekligrarryffsgtppgarlaalaaalgllglegleerler
00417041   1/1  erlrplrlggisidlkylvqelgfnsgtspiaaaaglaalegl..eeilerrreladylaeaLkelpgle
00494861   1/1  laealpllrggggetgrrsgllaaaalaalglegleelaarlreladylaegLael..glelvgppgani
00364061   1/1  .gGprgGyiagkdelqelieklrrlkaplgfgtalspliaaaalaalelleegleelaerlvenaaylae
00461651   1/1  gadivvgslsKtlngpgGlrgGalvgndeliealrkvrrglggtlsplaaaallaalegl..eerrerlr
00401341   1/1  ailvrdelaeklrsllfgggfggtlspllaaallaalelleeglkerrerlvenaarlaeaLeel.gfvv
00503901   1/1  pGlRlGyvvappeliealrklrsaltlgvsplaqaaaaaaledgelrlerleehleelrarlrerrdlla
00500761   1/1  lgrdeliekarllrkrlggllrqagllaaaalaalgeegleellaranalarrlaegLaal.pglelvgp
00487471   1/1  lrggggggtlsplaaaallaaletl..eerlerlrenadllaeaLeelpgvtlvlypglpshpghelakk
00451711   1/1  RvGylvappeliealakvksqllllirgltlnpptlaqaaaaaaledgalreeweeeleelrarlrerrd
00490701   1/1  rlppllfgggtvadsfyldltlqpaeqerrfeagtpnvaliaalaaalellglegleaiaarhleladyl
00517571   1/1  lggspsplvaaallaalktlllrgfkryleealklakalaeylyeglkklpglegfkvvspgggnilsfi
00470951   1/1  rlknrklpplsgggdlllllkfmladqerrfeagTppvaliaalaaalellleeGleairarhreladal
00506961   1/1  pGlRlGylvappeliealrklrsgltlgvstlaqaaaaaaledggyeehleelrarlrerrdlllealke
00474411   1/1  .lsgylglallldlqekrfepgtppvlaiaallaalellleeglerrarlaeladalragleal..glel
00354011   1/1  lpdaygrvivlgsfsKtlglpGlRlGylvappeliealrklksa.tlsvstlaqaaaaaaledgelleeh
00511951   1/1  klllggglggtlspaaaaaalagletl..eerrarlrenadrlaeaLael....ggvalvgypglpshpg
00460241   1/1  sfSKtfglpGlRlGylvapeeliealrklkgggllraltlsvstlaqaaaaaaledgleehleelrerlr
00473401   1/1  elidklrgllvglgggtlspaaaaallaaletl..elrreralenadylaelLael....pgvylvgypg
00393411   1/1  dpeliealrklrsgggstpsplaqaalaaaledgeehleelrerlrerrdllaeaLael.pgvevvgppg
00479561   1/1  ieallklrs..plgvstlaqaaaaaaledg...eyleelrarlrerrdllaealeelg.lkvlkpsggff
00521641   1/1  llvasahKglggppGlGflyvsedllerleplllgggslyldlkllldyllayqergfeagTppvaliya
00367801   1/1  ealrklrpggglggtlspaaaaallrgletl..elrreraqenadylaelLeelglvvlvyypglpsgaf
00380341   1/1  gGyvvgsdeliealrklrlgggfggtlspaaaaallrgletl..elrrarlrenadllaeaLael....p
00460561   1/1  elgaDfvvfsghKl.lGppGvGflyvrkellerlppllvgggqvaavsldlalqlrllerrfeagtpnia
00428061   1/1  fglaGlRvGylvapaeliealakvlsqlklliraltsnppalaqaaaaaalsdgellelwleeleelrer
00389521   1/1  pldlgrvivlgSfSKtlglpGlRlGylvakppeliealr..klrsplsvsslaqaaaaaaledggfleeh
00375691   1/1  aGlRvGylvappeliealrklrsp..lgvstlaqaaaaaaledgllehleelrerlaerrdllleaLeel
00350731   1/1  fSKnfglaGlRvGylvappelieallrvksqlkllirslysnpptlgqaaaaaaLsdpelraewleelee
00445951   1/1  adlda.grvivlfSfsKtlglpGlrvGylvappeliealrklrslgglgvstlaqaaaaaaledglfleh
00469651   1/1  GylvappeliealrklrspgnssvstlaqaaaaaaledgeflehleelrerlrerrdllleaLael..gl
00456391   1/1  lpGlRvGylvapnkdaelakelisalkklkrpltsnpptlaqaaaaaalsdpelreewleeleelrerlk
00461541   1/1  ltrdelldellrllrgfgfdlakkinsavfpglqggplnhviaalaaalklaqleefkeyaeqvvanara
00476701   1/1  vplgcgallvrdkellrralsvdadylgslddggdgvrdlrdftlegsrrfralklwaalralgreglre
00495241   1/1  ...ldelgaDfvvfsahKwl.gppGiGalyvrkelldkllpllrggggivlvslfgltaaeqerrfeagt
00358461   1/1  vDeAhgagayggpgrglaehlglpplaleagadivvgslhKtlgaltqtGwlhvrggyiagpkelidalr
00523021   1/1  ilvivDeaqatggllydglelg.....adivvfSfsKylggtGdrlGglvvtndkelierlrplrsggts
00423831   1/1  cGvvlvrdkellrealsvnadylggdlgsftlegsrpgaralalwaallslgregyeelverilelaryl
00528621   1/1  tv.lsleelealaelarkhglllivDeayaelvfdgepppslldalgrvivlgsfSKtlglpGlRlGylv
00513231   1/1  ylvappeliealrklksalglgvstlaqaaaaaaledgllglegdeehleelrerlrerrdllaeaLeel
00509771   1/1  fSKtfglpGlRlGylvavgppelieallkllllkslltlgvstlaqaaaaaaledgeehleelrarlrer
00412601   1/1  dalrklrgp.ltgstlspaaaaaalrgletlelrrerlaenaallaeaLeelgpgvevvlypglppegah
00408971   1/1  hglsrgllllvlaalllryevlllgynyrlspiqaaallaale..tlderlerrrenadrlaelLael..
00357001   1/1  Gpp.GlgvvivsedllerlepilpgyldyktvakngstanTpptlaiyalgaalewlleeggleaiearh
00450681   1/1  fglaGlRvGylvappevvladaellaalisallklkraltsnpsslaqaaaaaalsdgellaewleelee
00507681   1/1  lvappeliealrklrslltlgvsslaqaaaaaaledglydehleelrallrerrdllleaLeellppglk
00475811   1/1  liekarrlrkrlggglrqagvlaaaalvaledllellaeaherakrlaegLsel.ggvtlvlpvetnmvf
00452311   1/1  pelieallkvlsqlklliralpsnpptlgqaaaaaalsdpelralwleeleemrerlaerrdllveaLke
00519931   1/1  seralerleplllgggsisfyldlklllkymeayeqekgfeagTppvlliaalgaalellleegleaira
00462551   1/1  rspltlgvsslaqaaaaaallaygggeehleelrarlrerrdlllealeellpgllvvkpeggfflwldl
00527311   1/1  ----------------------------------------------------------------------
00460891   1/1  allklkspltlglvstlaqaaaaaaledgeeyleelrarlrerrdlllealkellpglkvlppegafflw
00459091   1/1  klrllrnhgtsksyhglkyvhlllgynyrlseiqAalglaqlekl..derlerrrenaklyaelLkkl.p
00462061   1/1  aapll....ldpldlgadvvvhsttKklgghggvrgGylvgnpellaallk.vlprllggplspfqaall
00405261   1/1  pltigvsslaqlaalaalkdpldaylllrgesletlelrrerlrerrellaeaLeelggvsypglpshpy
00445231   1/1  ..lnvstlaqaaaaaalsdldyleelrerlrerrdllveaLael..glevlppeggfylfldls..ldae


                         -         -         -         -         *         -         -:420
query           VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV------------------------
00516011   1/1  aglplvgdvrglgliigvelvddkatkepdlelaaalaealle---------------------------
00428091   1/1  gleelaa.hplvgdvrglglmlgielvddelaaalakalleeG---------------------------
00453921   1/1  sddgllalalaalllerGvllrpgggnvlrlspplaiteeeld---------------------------
00515171   1/1  ddkatkaalllllllllllllgpggnvirllppliiteeeide---------------------------
00435831   1/1  lvgdvrglGlmlgielvddkltkeplaelaaallrlllerGvl---------------------------
00529431   1/1  elgeylregleellakhplvgdvrglGlmlglelvkdkgtnil---------------------------
00521571   1/1  lmlglelvadkgtnivfvllpdaelaaalaaallerGvlvrp.---------------------------
00485711   1/1  sgnplaqaaalaalelleeeellerlreladylregLaellak---------------------------
00501571   1/1  ealakalleeGvlvrpggpgvlRlspslatteeeidellealae--------------------------
00440831   1/1  venakylaeaLeel..gvpvvgpvgghgvfldlellldgitgd---------------------------
00460071   1/1  glglivpvelgdgldalalaeallerGilvrpisypavplgeg---------------------------
00352461   1/1  anylaeaLeel..gvpvvtpvgghgvfldlelvldpipgdqf----------------------------
00467471   1/1  glpv...gpsdghivlvdlgdgllakalaeaLlerGilvrpig---------------------------
00507541   1/1  gnalaiaaaaaalrllgeeglkelaerlveladylaegLkel.---------------------------
00502611   1/1  rlrerrdrlaeaLeellpdlpglevvgpggglflwvdlpdgld---------------------------
00520701   1/1  laegLael..glpvv...gglgaivlvdlgdgvdakalaaall---------------------------
00465841   1/1  eladylregLeel.pglelvgppggrgpivsfelpggvdaee----------------------------
00448071   1/1  Leel..glelvgppgrrsgllvsfdlpdgvdaeelakaLleey---------------------------
00416741   1/1  gfflwldlp.gldaeelaealleagvlvrpgsafggpgllRls---------------------------
00421441   1/1  pglelvgppgrrlggivsfelp.gvdaedl..lllergiavsp---------------------------
00497541   1/1  lvpggglflwvdlpdllgvdaeelaealleeagvlvrpgsaf----------------------------
00355891   1/1  gglflwvdlpdlgldaeelaealleagvlvrpgsafggpgylR---------------------------
00533351   1/1  lrerrdllleaLkel...lpllgvsvvlpsgglflfvdlp...---------------------------
00507531   1/1  ctpnglaaaaalaaldllgleglearaeralalanylaaaLee---------------------------
00460871   1/1  rylaeaLkel..gipvvgptgghlvfvdlrkllphipgdtgls---------------------------
00489521   1/1  rlrenadylaeaLaelggvelvlppglpshpghylavrlprg----------------------------
00465471   1/1  l.pglellgppgrrgnivsfrlpgvdaedlakallekgiavrp---------------------------
00480741   1/1  ylyeglkel.glellgpdgrgrggivsfrlpdgidaaakalakallea----------------------
00459731   1/1  rrelakylaegLkelg..levlgpgldshpglvsfrlk.gida---------------------------
00417041   1/1  lvgppglsaphlfpvllplpeltelllplgglllwlfllegid---------------------------
00494861   1/1  vfvdlp.gvdaeelaaalleagiavspggpgalRlslglat-----------------------------
00364061   1/1  gLkel.gfvvvvgppgghivlvdlpgdgidakalakaLeeagi---------------------------
00461651   1/1  enadrlaeaLaelpgvervlypglpphggfflwvdlpegrggl---------------------------
00401341   1/1  vvgppdghlvsvdlpglgidaldlakaLeeagiavrlgshPav---------------------------
00503901   1/1  ealeelg.lkvvppeggfflwvdlpelllkalalllllgglda---------------------------
00500761   1/1  petnivffrlpg.....ellerllergiavspgsagpgvlRlv---------------------------
00487471   1/1  lvpggggllsvelkdgedaeelldalkeagiavslgsafslil---------------------------
00451711   1/1  llvealaelplpgglevvvpqggmflwldlp....de---------------------------------
00490701   1/1  aegLaalpavpglellgppdaarrgglvsfrlp.gaealakaL---------------------------
00517571   1/1  lpvdlgdgidalelaklllelygiavspgshpgvpdgliRlsv---------------------------
00470951   1/1  reglealglellgpdpaarspgvvsfrlpegvdaeellaalle---------------------------
00506961   1/1  llppglevvppeggfflwldlpegldaeelaealleegvlvrp---------------------------
00474411   1/1  l.pegrsggvvsfrlpdgidaaalakaleeagiavspgsafla---------------------------
00354011   1/1  leelrerlrerrdllleaLee..lglevlppegglflwvdlpe---------------------------
00511951   1/1  helakkvlpgrggfvsfdlpgggedaeafadaLkeagiavspg---------------------------
00460241   1/1  errdllaealeel.pglevvppeggfflwvdlpelllktglda---------------------------
00473401   1/1  lpshpghelakkvlpgrggfvsfdlkggvdaealadaLeeagi---------------------------
00393411   1/1  gfflwvdlpglgldaeelaeaLleeagvavrpgsafg.gpgll---------------------------
00479561   1/1  lwldlpldaeelaerlleegvlvrpgsafgllgegylRlslg.---------------------------
00521641   1/1  lgaalellleegleairarhreladalreglealglellgpdp---------------------------
00367801   1/1  yllaklpakgrggllsfelkgdaeavaklldelgvavrpgslg---------------------------
00380341   1/1  gvvlvlypglpshpghelakrqlpggggivsfelkgdgeda-----------------------------
00460561   1/1  giaallaalellgeegleairarlraladylaegLaalpglel---------------------------
00428061   1/1  laerrdllveaLaelggpgdldvikpqggfflfl------------------------------------
00389521   1/1  leelrerlrerrdllleaLee..pglevlppegglflwvdlpa---------------------------
00375691   1/1  .glvsvvgpsgglflwvdlp.daeelaealleegvavrpgsaf---------------------------
00350731   1/1  mrarlkerrdllveaLeklggpgdldvilpqggmflfvgl------------------------------
00445951   1/1  leelrarlrerrdllleaLaelglrvlkpeggfflwldlp..d---------------------------
00469651   1/1  evlppeggfflwvdlpelgldaeelaerlleeagvlvrpgsaf---------------------------
00456391   1/1  errdllveaLkklptpggldvikpqggfflfldlpd.---------------------------------
00461541   1/1  laeaLael..gfklvsggtdnhlvlvdlrdl.gldgkelaka----------------------------
00476701   1/1  lierlielarylaegLrelpgfellgepelglvvfrlkpadal---------------------------
00495241   1/1  pnvaaiaalaaalellqeegleairerhreladyllegLkelp---------------------------
00358461   1/1  fnraysllystspsyplqaallaalellageegeelrerlie----------------------------
00523021   1/1  isyvglvtldllprrfeagtpnvagliglgaalsplqaal------------------------------
00423831   1/1  aelLekl.ggfellsdgepalpvvafrlkpgdallplldaadl---------------------------
00528621   1/1  appeliealrklkspltlgvsslaqaaaaaaledgeehleelr---------------------------
00513231   1/1  g..lkvlppeggfylwvdlpelllalkllkglggldalelaer---------------------------
00509771   1/1  rdllvealeelp.glevlkpsggfflwldlpelgledaeelae---------------------------
00412601   1/1  ylalrvlklpgaggivsfelkgdaealaalldelgiavrpgs----------------------------
00408971   1/1  ..pgvelvkppglsshafylfailvlllglgldrdelaeaLee---------------------------
00357001   1/1  aelaallyealdalglvyllvvdpelrsgmvvsftlpdgvlak---------------------------
00450681   1/1  mrerlkerrdllveaLrelglpgdlsvikpqggfflwvgl------------------------------
00507681   1/1  vlppeggfflwldlpdgldaeelaealleegvlvvpgsafglg---------------------------
00475811   1/1  vrlpgaaidalellellleegvllvplgpglvRlvthldvseedvde-----------------------
00452311   1/1  lggpgdldvilpqggfflfldlp....defverlleeagv------------------------------
00519931   1/1  rhaelaealragleal..glellgpladpelrsptvtavkgpe---------------------------
00462551   1/1  pelllddaefllrllleagvavvpgsafglggegylRlsfa..---------------------------
00527311   1/1  ----------------------------------------------------------------------
00460891   1/1  ldlpelgldseelaerlleeagvlvvpgsafgllgegylRisf---------------------------
00459091   1/1  gvelpkppglashsayylfpillkdglglsrdellefllkkgi---------------------------
00462061   1/1  lrg....le-------------------------------------------------------------
00405261   1/1  helakkvlpggafyvllklkgdslefaeklleelgvlvrpgsg---------------------------
00445231   1/1  elaerlleegvlvrpg.pgylRislatpeendrleealer------------------------------