[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO48876.1


[Show Plain Result]

## Summary of Sequence Search
   1::151
  39::145  2.4e-16 28.6% 0043518 00435181 1/1   drug resistance efflux transporter EmrE 
   1::151


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSAKRVYILMVLAALFWSGAFITGKLAVREFPPFALTFFRFSFALPFVLWEKPLTYLPNATTEGWLAILY
00435181   1/1  --------------------------------------lrlllaallllpfalllkls..pgrtwlllll


                         -         -         *         -         -         -         -:140
query           MAVFASVLGYLFQLIAIQNIGAPKAAIFINLVPVFTIMQSLLFLGEPFSWFKMLSACIIVTGVYLTTRPE
00435181   1/1  lgllltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsllqllGialilaGvlllllg


                         +         -         -         -         -         *         -:210
query           SGVKEAAGIKA-----------------------------------------------------------
00435181   1/1  grrrk-----------------------------------------------------------------