[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO49033.1


[Show Plain Result]

## Summary of Sequence Search
   1::153
   4::154  1.6e-44 47.0% 0041180 00411801 1/1   oyl-dependent histidine and arginine de 
   1::153


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLPTPKKYFVTAASSEGKSKLTAFDNALLKARIGNVNLLRVSSILPPGCQEDPGMVLPPGSLVPTAYGYI
00411801   1/1  ---elllgtliPkkvfltsGvGegetelaafdlAlldAgienfnLvrvssilPpgaeivgldklppGeil


                         -         -         *         -         -         -         -:140
query           VSNVPGEIISACVGVGINSNDSFGVIMEFSGKCSKEEAEQNITNMVKEAFETRGMELKDIKIASAEHKVE
00411801   1/1  fvvmariasnepgelisaavgvAipkdknglGliseyhgygskedveelaremlkkmlelrglelveilv


                         +         -         -         -         -         *         -:210
query           KIGCALAAVPLWY---------------------------------------------------------
00411801   1/1  laesvtveklglal--------------------------------------------------------