[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO49533.1


[Show Plain Result]

## Summary of Sequence Search
   1::2558
 419::706    7e-17 25.8% 0047693 00476931 1/1   rin alpha N-terminal domain             
 398::707    3e-16 25.1% 0049735 00497351 1/1   rin alpha N-terminal domain             
   1::2558


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGNKIKSFTNQKDKSKISFTELSLPKGGGAIKGIGETFQPDPFSGTANLSIPVQMSPCRDFEPKISLNYN
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SGTGNGIFGIGFSISIPNISRKTEKGIPRYNDTDTFLFSNAEDLVSKMVKNQEGSWVKEERHVEENRVGW
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KVLSYIPRIEGLFAQIEYWQNSWESFWKVTTKDNTTSIYGQSENARIADPHDNTRVFKWLIEKTYDAKGN
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KIEYFYKQEDNENAPDNICEKNRTYATNKYVSSIKYGNYLDGKGEEAWAFEVVFDYGQYDISDQYLSQPG
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           CNPYIPARKWPARQDPFSSYRSGFEIRTLRLCRNILMFHHFKKELGETPCLVKATQLTYREPAQQLQNSN
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           NPFTKILQLSQVELKGFKRKENGSYQFRSMPSLKLTYSCLMPAGGKFDTLKVGNSTAVPVSTGQIRYNFV
00476931   1/1  --------------------------------------------------------------------aa
00497351   1/1  -----------------------------------------------sagfvirglvssvksgqslgaag


                         -         -         +         -         -         -         -:490
query           DLYGDGIPGLLYSDDKATLYWKPKGNGEYEYPEPAAQFPIEKDLKKGEYTLVSLEGNGRLDLVVGTPQRG
00476931   1/1  DldgDGdlDlvvggsydwsgtvyvylnngngtfssqlllslgdgtftdvteaaginldsylgysvavgDf
00497351   1/1  DlngDglldlavgaflqllknlkaiaslptgtvyvllnngdgtftlvpllgelifalegtllglagsgfg


                         *         -         -         -         -         +         -:560
query           GFYEGNPDGSWHSYRDFATYPLDFTNSHKEMIDMNGDGLADLLLYEDNTAKIYPSLKKKGYGIPTRASLS
00476931   1/1  ngDGdlDlvvgaprgnhltgavylndgdgtftlqvlvgtgggsyfgssvavgDlngDGllDllvga....
00497351   1/1  qsgasaDldgDGdlDlvvggsydwsgtvyvflgadsllsgslalylnngdgtftsvsalagvagnsylgy


                         -         -         -         *         -         -         -:630
query           EDYPTTSNGYAEEVLSYADMFGDGMAHRVRIRNGSVECWPNLGHGRFGKRVLFANAPRFGDTLDASRLFL
00476931   1/1  ......................................plysdrgitgklaeggrvyvylnngdgtfsdv
00497351   1/1  svavgDfdgDGdlDllvggaprendttgavylfln.dgdgtftls...glqagsyfgss...vaagDldg


                         -         +         -         -         -         -         *:700
query           ADLDGTGMTDLIYAYPDKVQVFFNQGGNSFSPPLSIPLPETYSNLDQLGFADVKGNGTACLVFIKTGANA
00476931   1/1  allsgla..ggrfggasaalgDldgDGllDlvvgapledpggdgavyiylgngdglfskpsqviggsslg
00497351   1/1  DGllDllvgaplysdrglpgllaeggrvyvylnngdgtfsdvaslvgggassggrfGsasaalgDldgDG


                         -         -         -         -         +         -         -:770
query           KQYYYDFSEGTKPYLLTGIDNNLGALTNIKYTSSVKYYLHDKMAGKPWKTKLPFPVQVVEKVESIDKISG
00476931   1/1  lsggsg----------------------------------------------------------------
00497351   1/1  llDlvvg---------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LKLTTQYKYHDGFYDSVEREFRGFGFVEETDSEDFFTYAKPGLLENVAFYGLEEEHHVPPVLTKRWYHIG
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           ACIEEGVVSKQCEKEYYQQDKRGFSIPDSTFDDVVRQGCAETLRQAYRALKGQVIREEVYALDYIEGRTG
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           HPYTVTETNFHVRLIQPLIGENRAVFSVYKKETVSFNYERNPNDPQIQHEFILAVDDFGNVKKSCRVFYP
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           RRATPKDAVSVVHPEQTKIKAIVDLHSFINNSLDFWLLGISYESKTLEIGALDLQGQACFSFTKIKDQVG
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           RALQNCIRNDEKFSSDKVQARLLSWERNYFWNEAQDAPLPLGQITDKALLHHSEEAVFSQELLNTVFNGK
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           ATIDMLEKEGGYAFQEGYWWNRGLVQHYLKDRFLLPWKTENSYTSFPSSLYAKAVYEYDQYSLAPVKATK
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           FITDKITNTSSALLDYTILLPVQITDINDNVSQAFFDPLGMVIATSVFGTMGGKPAGDRDLKEYKAIPQV
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           DTTFDDVLANPHKYLQDATTYFYYDLSAWKNKGQPARSVQLTRETHVSDLAAGEKSGMHIQINYSDGFGR
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           EIEKKLKADAGEAVLRDNAGKPVYDAAGKIVKDFAQDRWIVSGRTVYNNKAKPIKQFIPYFSATPDYELQ
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           KDIDPILPKPTIIYYDPLLRVVKTVNPKGFFSKVEFTPWEEKHFDENDTVRDSVYFKNFKETYSKDPSQE
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:1540
query           QRDEKDALDKASRSYNTPDTKVLDNTGQTFLEIRNNLGEITKDILQDIVKGTEVNCQELWDELKSKGYIE
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:1610
query           TGDPPSAMGWVSGKFRPYFKGFMLGLDGRYKQFEEKIINLLKENCLTTYHELDIQGNVLFSVDPRLYYSN
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:1680
query           LKDHTDYYNFKYVYDMQKKPLSVDSADAGLKLSLSNIFGNTVHSWDSRGFHTRKMYDSLQRCVQIGVEGN
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1750
query           DGRGLVLHQAVEKFVYGEFYEEKEEASKDKNLRGQVYKHFDQAGVVTCNLYNLKGKAVQTDRQFLADYKK
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1820
query           EANWDNVNKSSLADELFSIGCSYDALERVISETAPDGSIYTHIYNQAGLLRKVVVAFKDGSEEEFIKDIQ
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1890
query           YNANGQRLKIIYGNGVTTEYSYTDPALRLTDILSLKPDSNNTKDFKGCLLQKIHYTYDPVGNVTRLRDNS
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1960
query           YPTVFYNQQKVEPLSDYSYNPLYQLVSATGRQHPGIFDGSHRDGFKQSKFIPIKSSNPNDGTSLENYRQD
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:2030
query           YQYDEAGNLTNIRHISSSTSWTRQLDISKGTNRTVQIASLNGAKNFFKTAYDPCGNMLNLENLASINWSY
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:2100
query           RNNLSRVDVILRENNSSDSEYFIYDSSGQRVRKVSERKCGSLREIEEKLYLGNFEIKRIKKKSDHLESQI
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:2170
query           LDRQSLHIMDGKSRIAITDIWLKDDLNRETEKTMERKFRYQLNNNLGSACLEVDEKVNIISCEEYFPYGG
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:2240
query           TSFIAGRDKREVKLKEYRYCGKERDDSTGFYYYGARYYLPWLGRWINPDPAGTVDGLNLYSFVKGNPVNF
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:2310
query           IDTSGKVGGSWLHLLYGGLTALAVGLIGGAAVGTGDYASPVVAALAGLAGMLFNKDKSALGALAIAGAGA
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:2380
query           IGSAVGGYVGRGTMSKLKEKDWQTTSVARTGLVASGLTGGTIGSLGVLAVQAVTRQFNTHNILMGAIAGF
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:2450
query           GGGILASGAQFGLFKPGDAKVPTMPVRAELKDLLPYQTRAFDRHYLELNPNPEELITNLKPKHFTVIDEE
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:2520
query           TQQRVKCDLVAVHGYPRFSFVQSVHGDYNQYIDKEKLVQLLQQAGFPHQDSTTGKNIPIKLATCFGGFWE
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:2590
query           SWFSTAQLVADKLGTEVYAHRWPVTVAQQSPWKKFTPN--------------------------------
00476931   1/1  ----------------------------------------------------------------------
00497351   1/1  ----------------------------------------------------------------------