[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO49673.1


[Show Plain Result]

## Summary of Sequence Search
   1::578
 423::580  2.6e-43 36.6% 0038146 00381461 1/1   e domain of HSP90 chaperone/DNA topoiso 
 427::576  7.6e-41 39.3% 0051393 00513931 1/1   e domain of HSP90 chaperone/DNA topoiso 
 416::574  1.4e-40 37.2% 0039624 00396241 1/1   e domain of HSP90 chaperone/DNA topoiso 
 426::577    1e-39 34.7% 0052097 00520971 1/1   e domain of HSP90 chaperone/DNA topoiso 
 429::573  2.3e-39 39.9% 0043142 00431421 1/1   e domain of HSP90 chaperone/DNA topoiso 
 431::574  2.2e-38 37.3% 0035339 00353391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 423::576  2.5e-37 36.1% 0046033 00460331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 429::574  1.3e-35 33.8% 0038974 00389741 1/1   e domain of HSP90 chaperone/DNA topoiso 
 434::577  2.3e-32 42.2% 0040344 00403441 1/1   e domain of HSP90 chaperone/DNA topoiso 
 451::573  1.9e-31 35.0% 0048223 00482231 1/1   e domain of HSP90 chaperone/DNA topoiso 
 454::573  3.1e-28 35.6% 0043939 00439391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 413::573  8.6e-28 33.1% 0042491 00424911 1/1   e domain of HSP90 chaperone/DNA topoiso 
 452::573    3e-26 35.0% 0035364 00353641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 450::573  2.4e-25 35.2% 0043038 00430381 1/1   e domain of HSP90 chaperone/DNA topoiso 
 452::573  3.1e-25 35.3% 0040105 00401051 1/1   e domain of HSP90 chaperone/DNA topoiso 
 434::573  3.5e-25 28.2% 0037015 00370151 1/1   e domain of HSP90 chaperone/DNA topoiso 
 467::573  1.6e-24 33.3% 0038465 00384651 1/1   e domain of HSP90 chaperone/DNA topoiso 
 445::573  5.2e-24 29.9% 0035784 00357841 1/1   e domain of HSP90 chaperone/DNA topoiso 
 450::573  4.1e-23 27.4% 0044566 00445661 1/1   e domain of HSP90 chaperone/DNA topoiso 
 448::573  1.8e-20 26.0% 0043464 00434641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 450::573    1e-19 29.5% 0053133 00531331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 342::429    1e-16 28.4% 0052096 00520961 1/1   imeric domain of signal transducing his 
 468::573  1.7e-15 23.5% 0043462 00434621 1/1   e domain of HSP90 chaperone/DNA topoiso 
 245::355  3.6e-14 28.4% 0046377 00463771 1/1   ike sensor domain (PAS domain)          
 221::340  4.4e-14 21.0% 0048459 00484591 1/2   ike sensor domain (PAS domain)          
 350::423  6.8e-14 28.4% 0039683 00396831 1/1   imeric domain of signal transducing his 
 219::343    4e-13 20.3% 0037219 00372191 1/1   ike sensor domain (PAS domain)          
 239::343  4.5e-13 25.7% 0041279 00412791 1/1   ike sensor domain (PAS domain)          
 239::347  7.7e-13 22.9% 0048715 00487151 1/1   ike sensor domain (PAS domain)          
 241::344  1.2e-11 25.0% 0046045 00460451 1/1   ike sensor domain (PAS domain)          
 237::344  1.5e-11 23.8% 0040536 00405361 1/1   ike sensor domain (PAS domain)          
 233::341  1.6e-11 24.5% 0050109 00501091 1/1   ike sensor domain (PAS domain)          
 242::342  1.6e-11 20.8% 0046903 00469031 1/1   ike sensor domain (PAS domain)          
 232::339  2.8e-11 24.5% 0048248 00482481 1/1   ike sensor domain (PAS domain)          
 238::339  2.8e-11 22.8% 0048644 00486441 1/1   ike sensor domain (PAS domain)          
 243::344  1.7e-08 19.6% 0048579 00485791 1/1   ike sensor domain (PAS domain)          
 341::358      6.1 44.4% 0048459 00484592 2/2   ike sensor domain (PAS domain)          
   1::578


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIDRLISVPHLNQLVLYSIWEKFINGQRIETKDLFSETYKAWLRCVEYRINPYQITTESLSEEELSYRKS
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/2  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00484592   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KLTDMLELLTPHIETIKTTLSTHSDTFLILITDHEGFILESFTGKDSTKDLINVPYAPGIGYAEHLAGNN
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/2  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00484592   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GIGSVLATGIPLAVLGAEHFVKDFHRWSCVGSPIIGDKGDIIAVLGVFMPCGMESPYTFSLTVAATKAVE
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/2  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00484592   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AAIKQGQMEKQLQDTRKTLRNLMQQRNIIFNAMSQGVIILNHEGIVTFFNKAAEEIWHINADELVGRPFF
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------DgiivldldgrilyvNpaaerllGysaeellgknll
00484591   1/2  ----------erkraeeelreseerlralldslpdgiivlDadgrilyvNpaaeellGyspeeliGknlf
00396831   1/1  ----------------------------------------------------------------------
00372191   1/1  --------IterkraeealreseerlrallesapdgiivldldgrilyvNpaaerllGyspeellGksll
00412791   1/1  ----------------------------lleaapdgiwitdldgrilyvNpaferllGyspeellgknlr
00487151   1/1  ----------------------------lleaapdgifvldldgrilyvnpaflellGyspeellgksll
00460451   1/1  ------------------------------eaapdgivitdldgrilyvNpaferllGysreellgksll
00405361   1/1  --------------------------rllleaapdgilvldldtgrilyvNdaaerllGyspeellGksl
00501091   1/1  ----------------------a.rlralleaapdgiivldldgrilyvNpaaerllGyspeellGkpll
00469031   1/1  -------------------------------napdgiiitdldgrilyvNdaflellGysreellgknlr
00482481   1/1  ---------------------seerlralldaapdgiivlDadGrilyvNraaerllGyspeeviGrnlf
00486441   1/1  ---------------------------allenapdgiivlDadgrilyvNpaaeellGyspeeviGknlf
00485791   1/1  --------------------------------lddfifvldadGriiyvneaalrallGyspeeliGksi
00484592   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           CFSRCRRAEPLLIRSLKEANSFTNIECKCSNLLHEKYILVNISLLRDEKNAVSGAIGIYTDVTELRRQEA
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00520961   1/1  -------------------------------------------------------------llalalnea
00434621   1/1  ----------------------------------------------------------------------
00463771   1/1  dlippedrerllaalrralaggeplllgvelelrlrrkdGslfwvelsisplrdegge..gvvgvlrDiT
00484591   1/2  ellhpedlreavleallealatgepvrgelrlrrkdGsrrwv.svspirdedGevvgvvg----------
00396831   1/1  ---------------------------------------------------------------------a
00372191   1/1  dllppedrervlealrralaggeplllgvslelrlrrkdGelrwvevsaspirdeggr..gvv-------
00412791   1/1  elvhpedrervlealrralaggepfsgelrlrrkdGslrwvllsispirdedGevvgvvgiar-------
00487151   1/1  dlihpedrervlealeealaggepfsgeyrlrrkdGsyrwvevsaspirdeldgkvvgvvgvarDiT---
00460451   1/1  lldllhpedrervlaalrralaggepfsgelrlrrkdGslfwvllsvspirdedGevvgvvgvv------
00405361   1/1  ldllhpedreavlealeralaggevvtlllllelrlrrkdGsvrwvevsaspirdeggrv...v------
00501091   1/1  dllhpedrervlealeralaggepvllgvegelrlrrkdGevrwvevsaspirdedg..vg---------
00469031   1/1  dlvhpedreavlaalwealrggepwsgelrlrrkdGelrwvelsispirdedGevvgfvgva--------
00482481   1/1  sellppedrpafeaallralatgep.lelrlrrkd.GsrrwvlvtvsplrdedGevvgv-----------
00486441   1/1  dllippedreevlealrealagge.svelrlrrkdGslrwvevsaspirdedGevvgvv-----------
00485791   1/1  ydfvhpedreesalrealeevlakgevrsfeyrflrkdGsyvwletsatpildpdtgklegvvg------
00484592   2/2  ------------------------------------------------------------Diterkraee


                         -         -         -         -         *         -         -:420
query           RIREQEKLAVVGQMAAGMAHEIRNPLTSVRGFAQLMSEKMAEEQNPYKEFMEIMIQEIDQADSFINNFLQ
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00396241   1/1  -----------------------------------------------------------------ndlld
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  --------------------------------------------------------------ylvedllv
00353641   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00520961   1/1  leeleealeakgeflanvsHELRtPLtailgylelllegllelldeelreyleiilesaerllrlindll
00434621   1/1  ----------------------------------------------------------------------
00463771   1/1  erkra-----------------------------------------------------------------
00484591   1/2  ----------------------------------------------------------------------
00396831   1/1  leeleealeakseflanvsHeLrtPLtailgllell.......deelrellelileelerllrlvndlld
00372191   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00484592   2/2  elreseer--------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LARPKPPKMQACSLNQLILNFIKIFESQAFLQGVKIGIDLGEIPTIVIDKDQIKQVLLNLCQNALQAMNM
00381461   1/1  --gklelelepvdlaelleellellrllaeekglelielvldldllllvlgdplrlrqvllnLlsNAika
00513931   1/1  ------eelepvdlaelleevlellrllaeekgieleldl.dlp.vlgdplllrqvllnLlsNAikytp.
00396241   1/1  lsrleagllelelepvdlaelleevlellrlla.ekgielvldldplllvlgdplrlrqvllnLlsNAik
00520971   1/1  -----elelepvdlaelleevlellrllaeekgieleleldpdllllvlgdplllrqvllnLlsNAikyt
00431421   1/1  --------aepvdlaelleevlellrlla.ekgielvldlapdlplvlgdplllrqvllnLlsNAikyte
00353391   1/1  ----------pvdlaelleellellrllaeekgieleleldgdelllvlgdplllrqvllnllsNAikyt
00460331   1/1  --grlelelepvdlaelleevlellrll..ekgielvldld.lllvlgdplllrqvllnLlsNAikyt..
00389741   1/1  --------lepvdlaelleevlellrllaeekgielvleldpdlpvlgdplllrqvllnllsNAikytpe
00403441   1/1  -------------laelleellelllllag.kgielvldldedlplvladallleqvllnllsNAikhal
00482231   1/1  ------------------------------lkilelvrkpplpiivggdprrleqvlrnLvsNAidatak
00439391   1/1  ---------------------------------lniqlevdglldiligsdysrleqvlreLisNAiDAl
00424911   1/1  lsrlea.......vrlrpdmyigllel.aeekgivleleldellllvlgdvegllqillelldNAidhal
00353641   1/1  -------------------------------fqaeikvlldleavllaagedierlaqvlreLvdNAida
00430381   1/1  -----------------------------laesiqfqveierlldilinadysrleqvlrELiqNAiDAg
00401051   1/1  -------------------------------kievlgillavrlrpgliivsgdverlaqvlkeLldNAi
00370151   1/1  -------------ldelledliavl......kglelvlkrpgmlilvtgdatglyrvvqelldNAidhal
00384651   1/1  ----------------------------------------------gedierlasvlkeLvdNAidag..
00357841   1/1  ------------------------lelkaiaeklgielevdrlldilagslysnleivlrELisNAiDAl
00445661   1/1  -----------------------------eaeklefqleverlldilvgslysnleivlrELisNAiDAl
00434641   1/1  ---------------------------rylaesiqvlialeevlerpgmyigstgllrvvkelvdNAida
00531331   1/1  -----------------------------lleklefqveverlldllikslysnleivlrELisNAiDAl
00520961   1/1  dlsrleagk-------------------------------------------------------------
00434621   1/1  -----------------------------------------------evveglahvvkelvdNAidaala
00463771   1/1  ----------------------------------------------------------------------
00484591   1/2  ----------------------------------------------------------------------
00396831   1/1  lsr-------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00484592   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           QGTITIATRFHAAEKEVSLSVRDNGPGIPGDNIDKLGTPFFTTKDKGTGLGLSISYTIVDKHQGRIEVES
00381461   1/1  tpegleegklelgtitvslrl..egdlvvisvsDnGiGippedlerifepffttkeaglsdlellnllll
00513931   1/1  ggtitislrle..gdlvvlsveDnGpgipeellerifepffrtdssrsggtGlGLaivkrivelhggtis
00396241   1/1  atpeggleslllptitvslrl..dgdlvvisvsDnGiGipeellerifepfyrtkssrsldsslrklgGt
00520971   1/1  peggllltitvslrl..egdlvvisveDnGiGipeellerifepffrtdssrsrelggtGlGLaivkeiv
00431421   1/1  peggtitvslrlllllllllllegdlvvlsvsDnGpGipeellerifepffrtdsggtGLGLaivkrive
00353391   1/1  ielleerlalgkpeggtitvslrr..egdrvvievsDnGiGipeelllekalekgllseeellslselel
00460331   1/1  ggtitvslrle..gdlvvlsvsDnGiGipeellerifepffrtdssrdlggtGlGLaivkrivelhggti
00389741   1/1  g....itvslrllgdllvlsveDnGpgipeellerifepfyrtdssrggtGlGLaivkeivelhggtitv
00403441   1/1  egpeggtitislrl..egglvvltvrDnGigipe..lerifepffttkesrggtGlGLaivke....hgg
00482231   1/1  ggvivivvilvivisedgglvritVsDnGiGIppeelpkiferfatskiksfsrliggtGlGlsivklls
00439391   1/1  aklvlllltdgkklaeggeitirikl..dkdnvlltvtDnGiGiteedlkkifepfatsktkgflealka
00424911   1/1  agpgairikvtldgdg..vsieVeDnGrGIpveilekifepffeliltvlhaggkfdddsykvsgggtGl
00353641   1/1  g..agrievsle...dgglvlitVrDnGiGipeddlprlferfatskissfddlsyivsiGgrGlGlasv
00430381   1/1  atrveisledegklgengeitikiladken..vlitvtDnGiGiteedlpkiferfatskkkeflellha
00401051   1/1  daapaggavtirvtldddg...sltVeDnGrGippedlprlferfytskltvllaggkfddlsykvsggg
00370151   1/1  aggavtisvtldgdg...sisVeDdGrGippeileriferfyelvltvlhagskfdddsykvsggghGlG
00384651   1/1  atrievtle...dgglllieVsDnGiGipeedleklferfatskisgfddlssrvtlGfrGlGlasvkal
00357841   1/1  aklrlilltdeklageggeitirllp..dkeeltltvsDnGiGitkedlinifgtfatsgkkgfleylvd
00445661   1/1  aklvylsltdgkltleggeiririlldkdnltltvsDnGiGitkedlekifgtfatskkkgfleklsdla
00434641   1/1  alaggavrievtldddg...sisVeDdGrGipvdilpkifepfveliltvlhagskfddlsykvsgglhG
00531331   1/1  aklvylsltdekllgeggeilirilp..dkdavtltirDnGiGmtkedlekilgtiatsgkkgflekldd
00520961   1/1  ----------------------------------------------------------------------
00434621   1/1  gkatrievtleadg...sieViDnGrGipvdilplykvsg.....glhGvGlsvvnalsellggtvtrdg
00463771   1/1  ----------------------------------------------------------------------
00484591   1/2  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00484592   2/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TIDEGTCFKVYLPVYEQF----------------------------------------------------
00381461   1/1  pglslaslvrdlgGtGlGLa--------------------------------------------------
00513931   1/1  vesepgggttftltlp------------------------------------------------------
00396241   1/1  GLGLaivkrivelh--------------------------------------------------------
00520971   1/1  elhggtitvesepgkGt-----------------------------------------------------
00431421   1/1  lhggtievesepg---------------------------------------------------------
00353391   1/1  lerifepffrtkss--------------------------------------------------------
00460331   1/1  tvesepgggttftltl------------------------------------------------------
00389741   1/1  esepgggttftltl--------------------------------------------------------
00403441   1/1  eitvesepgggttftit-----------------------------------------------------
00482231   1/1  elhggeitvesep---------------------------------------------------------
00439391   1/1  ggkedlsdirlig---------------------------------------------------------
00424911   1/1  Glsivnalsellg---------------------------------------------------------
00353641   1/1  ralaelvivtrta---------------------------------------------------------
00430381   1/1  gggtdlssrktiG---------------------------------------------------------
00401051   1/1  hGlGlsivnalse---------------------------------------------------------
00370151   1/1  lsivnalsellgg---------------------------------------------------------
00384651   1/1  sellggtitrdgk---------------------------------------------------------
00357841   1/1  gsdvsliggfGlG---------------------------------------------------------
00445661   1/1  didliGgfGlGly---------------------------------------------------------
00434641   1/1  lGlsvvnalsell---------------------------------------------------------
00531331   1/1  kadrsliGqfGlG---------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00434621   1/1  kvylqlfsrgvpv---------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/2  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00484592   2/2  ----------------------------------------------------------------------