[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO49707.1


[Show Plain Result]

## Summary of Sequence Search
   1::298
 175::296  5.2e-12 19.0% 0051014 00510141 1/1   ge-gated potassium channels             
 172::295  7.1e-10 17.2% 0042184 00421841 1/1   ge-gated potassium channels             
 201::293  1.2e-09 26.2% 0040580 00405801 1/1   ge-gated potassium channels             
 172::298  1.4e-09 21.8% 0037417 00374171 1/1   ge-gated potassium channels             
  97::298  1.3e-06 22.0% 0041998 00419981 1/1   ge-gated potassium channels             
   1::298


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLQELFSSFAVVFVLLGTVLLFMHSFAPVTRSQERQITITLDVFHLFRHISVLLKYSLLSIAQMPPLLL
00510141   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LFLILYGLVLSFYYWYQRMSLGLTGLLGLSILTTIISLGIIALILSPILFMTRKYLFDDMIESRIFRIAI
00510141   1/1  ----------------------------------------------------------------------
00421841   1/1  ----------------------------------------------------------------------
00405801   1/1  ----------------------------------------------------------------------
00374171   1/1  ----------------------------------------------------------------------
00419981   1/1  --------------------------igygriaplfdlgilllilynlvgiplellplldlgltlvllvl


                         +         -         -         -         -         *         -:210
query           YSVMVPFLYIFIIHDLTPGPLVEGIMFTGIVISYYQIFRGIIYCLQTPRTFFSYLDSRFIPILMIVSWLF
00510141   1/1  ----------------------------------lrvlrllrllrllkllrtlvrlrlrlllllllllll
00421841   1/1  -------------------------------lrllrllkllrllrdlrtlllllrlrlplllllllllly
00405801   1/1  ------------------------------------------------------------elllllllll
00374171   1/1  -------------------------------lrllrllrllrllrllrttlg..lrrsrrelllllllll
00419981   1/1  dlvftviFtleillrlraaglklrylrwnilDllavlpslllllllgsllllrvlrllrllrllrllrlf


                         -         -         -         +         -         -         -:280
query           VIIFNLYTMILLVSNTNPYSFIDSTGPVTEHIRLLYFTIITFTSVGYGDITPRGNFPVFITMIISITGFL
00510141   1/1  lllllgallfyllegllgd......slfwsfldalYfsvvTltTvGYGdivPvtplgrllailyillGll
00421841   1/1  lllgallfyllegllgd........slfwsfldafYfsfvTltTiGYGdivpvtplgrlfailyillGll
00405801   1/1  lllllgallfyllegw.............sfldalYfafvtltTvGYGdivPltllgrlfailyillGll
00374171   1/1  lllllgallfyliegdlgd......slfwsfldalYfsivTltTvGYGDivPvtplgrlfailyillGll
00419981   1/1  sglrrllrtllrslkal.....pllllllllllllligallfylleggigps......nfwsfldalyfs


                         -         *         -         -         -         -         +:350
query           YSALFIGGLLAAFTSRSK----------------------------------------------------
00510141   1/1  lialligliasllsep------------------------------------------------------
00421841   1/1  lialllgliaallae-------------------------------------------------------
00405801   1/1  lialllgllvsll---------------------------------------------------------
00374171   1/1  lfalligligsllarpyk----------------------------------------------------
00419981   1/1  fvtltTvGYGDivpvtpl----------------------------------------------------