[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO49715.1


[Show Plain Result]

## Summary of Sequence Search
   1::621
 326::620    1e-66 38.0% 0053558 00535581 1/1   l-accepting chemotaxis protein (MCP) si 
 391::621  1.5e-52 38.4% 0053501 00535012 2/2   l-accepting chemotaxis protein (MCP) si 
  53::196  4.4e-13 24.2% 0051947 00519471 1/1   ry domain-like                          
  57::192  1.7e-09 18.3% 0048676 00486761 1/2   ry domain-like                          
 203::267  0.00096 26.2% 0048676 00486762 2/2   ry domain-like                          
  57::197   0.0091 14.8% 0048581 00485811 1/2   ry domain-like                          
 203::240      0.2 27.0% 0048581 00485812 2/2   ry domain-like                          
 321::387      9.2 13.4% 0053501 00535011 1/2   l-accepting chemotaxis protein (MCP) si 
   1::621


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSMVPSSRIKPSGSLKFQVSVFIAILLIVCVMAVSWLSISKMEKAINQKVKEGEMVASLIIREEIQHFLD
00535581   1/1  ----------------------------------------------------------------------
00535012   2/2  ----------------------------------------------------------------------
00519471   1/1  ----------------------------------------------------kkleellerlelleklls
00486761   1/2  --------------------------------------------------------leqlidellqrala
00486762   2/2  ----------------------------------------------------------------------
00485811   1/2  --------------------------------------------------------lelledelgerala
00485812   2/2  ----------------------------------------------------------------------
00535011   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SKGEIVKNLSLAQEFQSQDKKQILKLLLSAQNQSEFQNIYFVTGSGEITIAPVKQLPKDFDPRQRVWYQE
00535581   1/1  ----------------------------------------------------------------------
00535012   2/2  ----------------------------------------------------------------------
00519471   1/1  elllllkkl.....laedldellllllflld..pfllrvYildedGlqispnivkddsnwlldpsylgkn
00486761   1/2  varllaaspaviealeagdrealqelleelrkltgadyivvtdangirlahpdper..iGdrlsggdvve
00486762   2/2  ----------------------------------------------------------------------
00485811   1/2  varllannplvieallsgdpsdalqalaeelrkatgadfivvtdrdgirlahsdpe..riGkplsgedik
00485812   2/2  ----------------------------------------------------------------------
00535011   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AVKKGTMVCTDPYIDQATGKPCMTVALAVKDSEGRFVGVLGADIKLETISSLAVKYKFGEEGYFYVCDKQ
00535581   1/1  ----------------------------------------------------------------------
00535012   2/2  ----------------------------------------------------------------------
00519471   1/1  wswRPYFleaivkmrsrgklilsdpyldlatgelcvtfsyplrde.....gvlvvD--------------
00486761   1/2  alltgesyvgiaegs...ggpslrayaPifdadgkviGvvsvgislesleql------------------
00486762   2/2  --------------------------------------------------------------yivvtdan
00485811   1/2  kal.nGeeyvsealgtlg...pslrafvPiyddngkviGvvsvGislssvdellldi-------------
00485812   2/2  --------------------------------------------------------------fivvtdrd
00535011   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GKVIGHPDAKAINGDIMNRAYVKAALAGKSGFDTYADNGVKKLVYYSEIPKTGWGLFVQQPEQEAYAELY
00535581   1/1  ----------------------------------------------------------------------
00535012   2/2  ----------------------------------------------------------------------
00519471   1/1  ----------------------------------------------------------------------
00486761   1/2  ----------------------------------------------------------------------
00486762   2/2  girlahpdperiGdrlsggdvvealltgesyvgiaegsggpslrayaPifdadgkvi-------------
00485811   1/2  ----------------------------------------------------------------------
00485812   2/2  girlahsdperiGkpls.gedikkalnGee----------------------------------------
00535011   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RARNMIIIITLLILASALVISLYFTGKMVNVIKMVGEGARAIAQGNLTYSLTIARKDELGILSDSINEMT
00535581   1/1  ---------------------------------------------Dltvrldvkskdeigelaralntmv
00535012   2/2  ----------------------------------------------------------------------
00519471   1/1  ----------------------------------------------------------------------
00486761   1/2  ----------------------------------------------------------------------
00486762   2/2  ----------------------------------------------------------------------
00485811   1/2  ----------------------------------------------------------------------
00485812   2/2  ----------------------------------------------------------------------
00535011   1/2  ----------------------------------------lveelaasleevaaaaeelaalveeiaela


                         -         -         -         -         *         -         -:420
query           NHLKTIIGGVKDSTNRVTGACNSMAVSMEQIHEASDKNASDISNVAATTEQITASAENINEMVGSVSLSA
00535581   1/1  dnlrelisev...........eelsegaeeqaasleevaaaleelsatveevaenaeeaaelaeeasela
00535012   2/2  ----------------------------------------lveelaasleevaaaaeelaalveeiaela
00519471   1/1  ----------------------------------------------------------------------
00486761   1/2  ----------------------------------------------------------------------
00486762   2/2  ----------------------------------------------------------------------
00485811   1/2  ----------------------------------------------------------------------
00485812   2/2  ----------------------------------------------------------------------
00535011   1/2  eeglelveeaveaieelaelveelveaveelsessee---------------------------------


                         -         -         +         -         -         -         -:490
query           QHGQEEIGEVIGAMEGIKSSTNEISRAISEVENQSKKIQHITTIITQIAEQTNLLALNAAIEAARAGEHG
00535581   1/1  eeglevveeaveaieeiaelveelaevveelsesseeIgeivdvIddIAeqTnLLALNAaIEAARAGEaG
00535012   2/2  eeglelveeaveaieelaelveelveaveelsesseeigeivdviddiAeqTnLLALNAaiEAARAGeaG
00519471   1/1  ----------------------------------------------------------------------
00486761   1/2  ----------------------------------------------------------------------
00486762   2/2  ----------------------------------------------------------------------
00485811   1/2  ----------------------------------------------------------------------
00485812   2/2  ----------------------------------------------------------------------
00535011   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KGFTVVADEVRKLAEQTSAATREIHGVIENVYASVRDSVDKMLTGNEMVEMGSQRVQEAGEVFKTITINI
00535581   1/1  rGFAVVAdEVRkLAertaeatkeIselieeiqeateeaveaieeslelveegvelveeagealeeivesi
00535012   2/2  rGFaVVAdEVrkLAertaeatkeiselieeiqeeveeavelveeagealeeiveaveeisdlveeiaaaa
00519471   1/1  ----------------------------------------------------------------------
00486761   1/2  ----------------------------------------------------------------------
00486762   2/2  ----------------------------------------------------------------------
00485811   1/2  ----------------------------------------------------------------------
00485812   2/2  ----------------------------------------------------------------------
00535011   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EELVEKMAQITRATITMSASIQNVAAASQEQAAIIEEENKMVEDLRQSAIVLDNMVQKFVV---------
00535581   1/1  eeisdlvseiaaaaeeqsaaieeiaraveeiaevteenaalaeevaaaaeelselaeell----------
00535012   2/2  eeqsavieeiseaveeiselaeetaalaeevaaaaee.......lselaeelkelvsrfkl---------
00519471   1/1  ----------------------------------------------------------------------
00486761   1/2  ----------------------------------------------------------------------
00486762   2/2  ----------------------------------------------------------------------
00485811   1/2  ----------------------------------------------------------------------
00485812   2/2  ----------------------------------------------------------------------
00535011   1/2  ----------------------------------------------------------------------