[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO49801.1


[Show Plain Result]

## Summary of Sequence Search
   1::916
 575::743  3.1e-44 39.3% 0038146 00381461 1/1   e domain of HSP90 chaperone/DNA topoiso 
 564::749  6.4e-43 38.4% 0039624 00396241 1/1   e domain of HSP90 chaperone/DNA topoiso 
 578::736  1.8e-41 37.6% 0052097 00520971 1/1   e domain of HSP90 chaperone/DNA topoiso 
 790::911  6.3e-39 45.8% 0043525 00435251 1/1   like                                    
 583::737    8e-39 39.2% 0035339 00353391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 579::739  1.3e-38 35.8% 0051393 00513931 1/1   e domain of HSP90 chaperone/DNA topoiso 
 786::918  1.1e-37 47.3% 0046299 00462991 1/1   like                                    
 787::913  1.2e-37 44.9% 0039925 00399251 1/1   like                                    
 581::736  3.3e-37 37.4% 0043142 00431421 1/1   e domain of HSP90 chaperone/DNA topoiso 
 575::752  4.5e-37 35.4% 0046033 00460331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 780::915  1.6e-36 42.1% 0050342 00503421 1/1   like                                    
 581::737    2e-36 38.2% 0038974 00389741 1/1   e domain of HSP90 chaperone/DNA topoiso 
 791::913  2.6e-36 42.3% 0047753 00477531 1/1   like                                    
 608::736  2.7e-36 41.1% 0048223 00482231 1/1   e domain of HSP90 chaperone/DNA topoiso 
 789::913  2.8e-36 45.2% 0047555 00475551 1/1   like                                    
 792::913  4.8e-36 45.5% 0050341 00503411 1/1   like                                    
 792::915  1.8e-35 44.2% 0051573 00515731 1/1   like                                    
 792::911  7.4e-35 44.5% 0048656 00486561 1/1   like                                    
 787::915  1.5e-34 44.5% 0048705 00487051 1/1   like                                    
 790::913  2.2e-34 42.7% 0047296 00472961 1/1   like                                    
 792::914  3.4e-34 43.4% 0045852 00458521 1/1   like                                    
 791::914  1.9e-33 43.8% 0048231 00482311 1/1   like                                    
 792::916  2.1e-33 45.1% 0047799 00477991 1/1   like                                    
 792::914  3.5e-33 43.8% 0046428 00464281 1/1   like                                    
 792::915    6e-33 44.7% 0048129 00481291 1/1   like                                    
 793::915  6.9e-33 42.9% 0051574 00515741 1/1   like                                    
 791::915  8.2e-33 45.5% 0050964 00509641 1/1   like                                    
 785::915  1.5e-32 42.2% 0051860 00518601 1/1   like                                    
 790::915  1.8e-32 42.3% 0047867 00478671 1/1   like                                    
 792::911  1.8e-32 41.9% 0049761 00497611 1/1   like                                    
 792::915    2e-32 43.8% 0051386 00513861 1/1   like                                    
 791::913  2.1e-32 44.2% 0051318 00513181 1/1   like                                    
 793::913  2.3e-32 44.1% 0048465 00484651 1/1   like                                    
 793::913  5.5e-32 42.4% 0048975 00489751 1/1   like                                    
 790::915  5.7e-32 40.7% 0046294 00462941 1/1   like                                    
 792::913  8.1e-32 42.0% 0049456 00494561 1/1   like                                    
 790::913  1.1e-31 42.5% 0045700 00457001 1/1   like                                    
 791::913  1.1e-31 42.5% 0045682 00456821 1/1   like                                    
 791::913  2.8e-31 43.6% 0048685 00486851 1/1   like                                    
 793::915  8.1e-31 42.9% 0048463 00484631 1/1   like                                    
 586::737  1.3e-29 38.8% 0040344 00403441 1/1   e domain of HSP90 chaperone/DNA topoiso 
 561::736  2.9e-29 35.1% 0042491 00424911 1/1   e domain of HSP90 chaperone/DNA topoiso 
 791::913    4e-29 39.3% 0051898 00518981 1/1   like                                    
 606::736  1.1e-28 32.8% 0043939 00439391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 782::913  1.2e-27 40.3% 0048997 00489971 1/1   like                                    
 789::913  1.5e-26 39.5% 0048066 00480661 1/1   like                                    
 602::736    1e-25 29.6% 0043038 00430381 1/1   e domain of HSP90 chaperone/DNA topoiso 
 602::736  6.6e-25 34.4% 0040105 00401051 1/1   e domain of HSP90 chaperone/DNA topoiso 
 597::736  7.9e-25 31.3% 0035784 00357841 1/1   e domain of HSP90 chaperone/DNA topoiso 
 586::736  9.9e-25 31.2% 0037015 00370151 1/1   e domain of HSP90 chaperone/DNA topoiso 
 602::736  7.6e-24 30.2% 0044566 00445661 1/1   e domain of HSP90 chaperone/DNA topoiso 
 606::736  2.8e-22 31.7% 0035364 00353641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 621::736  1.5e-21 35.2% 0038465 00384651 1/1   e domain of HSP90 chaperone/DNA topoiso 
 489::577    2e-20 44.9% 0052096 00520961 1/1   imeric domain of signal transducing his 
 256::431  1.4e-19 20.4% 0046710 00467101 1/1   omain-like                              
 273::460  4.3e-18 19.2% 0048135 00481351 1/1   omain-like                              
 602::736  4.6e-18 23.7% 0053133 00531331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 598::736  9.5e-18 29.0% 0043464 00434641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 497::571  3.7e-14 43.3% 0039683 00396831 1/1   imeric domain of signal transducing his 
 622::736  6.4e-14 28.9% 0043462 00434621 1/1   e domain of HSP90 chaperone/DNA topoiso 
 272::438  6.6e-13 18.5% 0050183 00501831 1/1   omain-like                              
 293::443  5.3e-11 16.2% 0048136 00481361 1/1   omain-like                              
 787::914  2.5e-05 18.4% 0035625 00356251 1/1   amin (vitamin B12)-binding domain       
   1::916


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLKTKLFLGLSGLFIILLLISGSAIYGMKKFNNNIEEIVKNRYQKVILVATIQFEINNASRYLRDLILE
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DNNTDLEIYNKMEESNKQILGAISALEKVSEVDELKQLTTEVKTAFNEYLKIEKTIYSLVQAGRRDEAKA
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VLYQNASVQTRLKLVQMIDDVGSIQQKQMELTVAQSKDVYNNIVFIFISLVLIGMVLGSGIVVWLIQNIV
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GNLHRVTLAMKSVSSHKDKTFLPRLDIVSSDEIGKISEVFNDMVEALEQHARQEKEKNLAIQEQHWLKSK
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ---------------------------------------------nlaalilelarlfeelqkrarllel
00481351   1/1  --------------------------------------------------------------radelda.
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  -------------------------------------------------------------errarelel
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VAEIMTLFQGVLDVKTFAQLLITRIPPIVGGCYGVFYVSVTEGEEQRLIKMASYASGGQDVGTSSFRPGE
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  lleiaellaseldleelleailellaellpllllgadrasiyllededggelvlgaaqglpagl......
00481351   1/1  llelslalss.ldldellelilellrellgadraslflldedg..gelvlvaadglgee..leirlplge
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  lleisallsseldldellelilellaellg..adrasiyllded.gelvlvaaqglpa....evriplge
00481361   1/1  ------------dleelldailellaellg..adraaiylldedggll.laaavgldpeellglriplge
00356251   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GLVGQCLLENKVIYLTNIPNQYIHITSGLGTAPAKCITVLPVEFEGKVVAVIELASFTELSSLQQELLEQ
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  riplgeGivgtaartgepvlvpdvsedprfia...cgagtrselvvPllssdgeviGvldldskepgafd
00481351   1/1  givgyvartgeplniddayedprfnvdldtgygtrsvlcvPlldsedgeviGvlelvnkkdgkaFteede
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  glagtvartgepllvedvsadprfial...dagirsllvvPlivdgeviGvlvldskepgafteedlell
00481361   1/1  glcgrvlrtgepvvvpdvsadprfaplpdlllelgirsllavPlldaggevlGvlvlasrleprafteed
00356251   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VRWNVGISLNRIGNHMQVQKLLADSQALTEELQTQSEELQMQQEELKTFNEKLENQYKESEQKTIELQKA
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  --------------------------------------------------------------------ll
00467101   1/1  eedlelLeala-----------------------------------------------------------
00481351   1/1  ellealaaqaaialenarlyeeaqrlaaeleilleilrdl------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  ealaaqlaialenarlye----------------------------------------------------
00481361   1/1  lellelladqlalalenarlyee-----------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KTALEEQASHLALSSQYKSEFLSNMSHELRTPLNSLLILARILVENKDGNLSPKQVEYAETILSSGNDLL
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  alalnealeeleealeakgeflanvsHELRtPLtailgylelllegllelldeelreyleiilesaerll
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ------aleeleealeakseflanvsHeLrtPLtailgllell........deelrellelileelerll
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           NLINDIFDLAKIEAGKLIVKPEQISLTELIYTLERQFQPIARQKLLDFTIQLDNDIPKTFFTDKNRLMQI
00381461   1/1  --------------gklelelepvdlaelleellellrllaeekglelielvldldllllvlgdplrlrq
00396241   1/1  ---ndlldlsrleagllelelepvdlaelleevlellrlla.ekgielvldldp..lllvlgdplrlrqv
00520971   1/1  -----------------elelepvdlaelleevlellrllaeekgieleleldpdllllvlgdplllrqv
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------pvdlaelleellellrllaeekgieleleldgdelllvlgdplllrqv
00513931   1/1  ------------------eelepvdlaelleevlellrllaeekgieleldl..dlp..vlgdplllrqv
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  --------------------aepvdlaelleevlellrlla.ekgielvldlapdlp.lvlgdplllrqv
00460331   1/1  --------------grlelelepvdlaelleevlellrll..ekgielvldld...lllvlgdplllrqv
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  --------------------lepvdlaelleevlellrllaeekgielvleldpdlp..vlgdplllrqv
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  -----------------------------------------------lkilelvrkpplpiivggdprrl
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  -------------------------laelleellelllllag.kgielvldldedlp.lvladallleqv
00424911   1/1  ylvedllvlsrlea.......vrlrpdmyigllel.....aeekgivleleldelll.lvlgdvegllqi
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  ---------------------------------------------lniqlevdglldiligsdysrleqv
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  -----------------------------------------laesiqfqveierlldilinadysrleqv
00401051   1/1  -----------------------------------------kievlgillavrlrpgliivsgdverlaq
00357841   1/1  ------------------------------------lelkaiaeklgielevdrlldilagslysnleiv
00370151   1/1  -------------------------ldelledliavl......kglelvlkr.pgmlilvtgdatglyrv
00445661   1/1  -----------------------------------------eaeklefqleverlldilvgslysnleiv
00353641   1/1  ---------------------------------------------fqaeikvlldleavllaagedierl
00384651   1/1  ------------------------------------------------------------gedierlasv
00520961   1/1  rlindlldlsrleagkl-----------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  -----------------------------------------lleklefqveverlldllikslysnleiv
00434641   1/1  -------------------------------------rylaesiqvlialeevlerpg.myigstgllrv
00396831   1/1  rlvndlldlsr-----------------------------------------------------------
00434621   1/1  -------------------------------------------------------------evveglahv
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LKNLLSNAFKFTNEGCVNLHVQRATKISEKGTQIVFSVSDTGIGIAKDKQALIFEAFQQGDGTTSRKFGG
00381461   1/1  vllnLlsNAikatpegleegklelgtitvslrl......egdlvvisvsDnGiGippedlerifepfftt
00396241   1/1  llnLlsNAikatpeggleslllptitvslrl......dgdlvvisvsDnGiGipeellerifepfyrtks
00520971   1/1  llnLlsNAikytpeggllltitvslrlegd..lvvisveDnGiGipeellerifepffrtdssrsrelgg
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  llnllsNAikytielleerlalgkpeggtitvslrre......gdrvvievsDnGiGipeelllekalek
00513931   1/1  llnLlsNAikytpggtitislrlegd......lvvlsveDnGpgipeellerifepffrtdssrs...gg
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  llnLlsNAikytepeggtitvslrlllllllllllegdlvvlsvsDnGpGipeellerifepffrtds..
00460331   1/1  llnLlsNAikyt.ggtitvsl......rlegdlvvlsvsDnGiGipeellerifepffrtdss..rdlgg
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  llnllsNAikytpeg.itvslrllgd......llvlsveDnGpgipeellerifepfyrtdssr....gg
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  eqvlrnLvsNAidatakggvivivvilvivisedgglvritVsDnGiGIppeelpkiferfatskiksfs
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  llnllsNAikhalegpeggtitislrle......gglvvltvrDnGigipe..lerifepffttkesr..
00424911   1/1  llelldNAidhalagpgairikvtldgdg......vsieVeDnGrGIpveilekifepffeliltvlhag
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  lreLisNAiDAlaklvlllltdgkklaeggeitirikl......dkdnvlltvtDnGiGiteedlkkife
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  lrELiqNAiDAgatrveisledegklgengeitikiladkenvlitvtDnGiGiteedlpkiferfatsk
00401051   1/1  vlkeLldNAidaapaggavtirvt....ldddg...sltVeDnGrGippedlprlferfytskltvllag
00357841   1/1  lrELisNAiDAlaklrlilltdeklageggeitirl......lpdkeeltltvsDnGiGitkedlinifg
00370151   1/1  vqelldNAidhalag....gavtisvtldgdg..sisVeDdGrGippeileriferfyelvltvlhagsk
00445661   1/1  lrELisNAiDAlaklvylsltdgkltleggeiririll......dkdnltltvsDnGiGitkedlekifg
00353641   1/1  aqvlreLvdNAidag.agrievsle.......dgglvlitVrDnGiGipeddlprlferfatskissfdd
00384651   1/1  lkeLvdNAidag.atrievtl.......edgglllieVsDnGiGipeedleklferfatskisgfddlss
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  lrELisNAiDAlaklvylsltdekllgeggeilirilpdkdavtltirDnGiGmtkedlekilgtiatsg
00434641   1/1  vkelvdNAidaalaggavrievt....ldddg...sisVeDdGrGipvdilpkifepfveliltvlhags
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  vkelvdNAidaalagkatrievtle....adg...sieViDnGrGipvdilplykvsg...........g
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           TGLGLSICRELAGLLGGFIELQSIKGKGSTFSVYIPTYDVETEFIEPARTEVAPGDDNSPIERDEIGKTE
00381461   1/1  keaglsdlellnllllpglslaslvrdlgGtGlGLaivrrive---------------------------
00396241   1/1  srsldsslrklgGtGLGLaivkrivelhggtitvesepggGttftltLP---------------------
00520971   1/1  tGlGLaivkeivelhggtitvesepgkGttftltLP----------------------------------
00435251   1/1  ----------------------------------------------------------------------
00353391   1/1  gllseeellslselellerifepffrtkssrsr.lgg---------------------------------
00513931   1/1  tGlGLaivkrivelhggtisvesepgggttftltlplas-------------------------------
00462991   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00431421   1/1  ....ggtGLGLaivkrivelhggtievesepg.gtt----------------------------------
00460331   1/1  tGlGLaivkrivelhggtitvesepgggttftltlplal...eladdlllll------------------
00503421   1/1  ----------------------------------------------------------------------
00389741   1/1  tGlGLaivkeivelhggtitvesepgggttftltlPl---------------------------------
00477531   1/1  ----------------------------------------------------------------------
00482231   1/1  rliggtGlGlsivkllselhggeitvesepgggstf----------------------------------
00475551   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00403441   1/1  ..ggtGlGLaivke....hggeitvesepgggttfti---------------------------------
00424911   1/1  gkfdddsykvsgggtGlGlsivnalsellggtvevk----------------------------------
00518981   1/1  ----------------------------------------------------------------------
00439391   1/1  pfatsktkgflealkaggkedlsdirliggfGlGla----------------------------------
00489971   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00430381   1/1  kkeflellhagggtdlssrktiGgfGlGlssvfsvs----------------------------------
00401051   1/1  gkfddlsykvsggghGlGlsivnalsellggtitvd----------------------------------
00357841   1/1  tfatsgkkgfleylvdgsdvsliggfGlGlysvfal----------------------------------
00370151   1/1  fdddsykvsggghGlGlsivnalsellggtitrdgk----------------------------------
00445661   1/1  tfatskkkgfleklsdladidliGgfGlGlysvfav----------------------------------
00353641   1/1  lsyivsiGgrGlGlasvralaelvivtrtadgkvat----------------------------------
00384651   1/1  rvtlGfrGlGlasvkalsellggtitrdgkvatrlf----------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  kkgfleklddkadrsliGqfGlGlysvflvadkvtv----------------------------------
00434641   1/1  kfddlsykvsgglhGlGlsvvnalsellggtvtrdg----------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  lhGvGlsvvnalsellggtvtrdgkvylqlfsrgvp----------------------------------
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           EWSGDKVSLSQIYSQGDKTLKGYRVLVVDDDMRNVFAITAALEEQEIEVLFAGNGREAQEILMQTPGIDL
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  -------------------msglrvLvVDDdplirellrrlLerlgyevvgtaadgeeAlelleelp.pd
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  ---------------lllelsglrvLvVdDnplnrellkalLeklgyevltasngeealell..elppdl
00399251   1/1  ----------------plslsglrvLvVdDdplirellrrlLeklgylevvltaadgeealellrelgal
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  ---------llllllsllllsglriLvVdDdplirellarlLeklgyev..aadgeealellrelp.pdl
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  --------------------kglriLiVdDdplirellrrlLeklgllyvvltaadgeealellrellal
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  ------------------llsglriLvVdDdpllrellrllLeklgyevvleaadgeealellrelr.pd
00503411   1/1  ---------------------glriLvVdDdpllrellrllLeklgyevltaadgeealellrelr.pdl
00515731   1/1  ---------------------glriliVdDdpllrellallLeklgyvvltaadgeealellrelr.pdl
00486561   1/1  ---------------------glrilvvdDdpllrellkllLeklgyevvlvaadgeealellrellesg
00487051   1/1  ----------------llllsglriLvVdDdplirellallLeslgyevvltaadgeealellrelp.pd
00472961   1/1  -------------------lsglriLiVdDdplirellrrlLeklgllyevleaadgeealellrellel
00458521   1/1  ---------------------glriLvVdDdpllrellallLeslgyvvltaadgeealellrelr.pdl
00482311   1/1  --------------------sglrilvvdDdpllrellallLeklgyvvltaadgeealellrelr.pdl
00477991   1/1  ---------------------glrilvvdDdpllrellallLeklgyvvltaadgeealellrelp.pdl
00464281   1/1  ---------------------klrilivdDdpllrellrllLeslgllyvvltaadgeealelleelr.p
00481291   1/1  ---------------------glriLvvdDdpllrellallLeklgyvvltaadgeealellrelr.pdl
00515741   1/1  ----------------------lriLvvdDdpllrellrllLeslgyvvleaadgeealellrelr.pdl
00509641   1/1  --------------------sglrilvVdDdpllrellrllLeslgyevltaadgeealelleelr.pdl
00518601   1/1  --------------ealsslsglrilvVdDdplvrellrrlLerlgyevvtaadgeealellrelp.pdl
00478671   1/1  -------------------lsglrilvvdDdpllrellallLeslgyvvltaadgeealellrelr.pdl
00497611   1/1  ---------------------glrilivdDdpllrellallLeklgyevvgeaadgeealellrelr.pd
00513861   1/1  ---------------------glrilvvdDdpllrellallLeslgyvvltaadgeealellrelr.pdl
00513181   1/1  --------------------sglrilvVdDdplirellrllLeslgyevltaadgeealellrelr.pdl
00484651   1/1  ----------------------lriLiVdDdplirellrllLeklgyevltaadgeealelleelr.pdl
00489751   1/1  ----------------------lriliVdDdplirellrllLerlgyevltaadgeealellrelr.pdl
00462941   1/1  -------------------lsklriliVdDdplvrellallLeslgyvvltaadgeealellrelr.pdl
00494561   1/1  ---------------------klrilivdDdpllrellallLeslgyvvltaadgeealellrelr.pdl
00457001   1/1  -------------------lsklriliVdDdplirellrrlLeslgdlyvvltaadgeealellrelr.p
00456821   1/1  --------------------kklriliVdDdplirellrrlLeslgdlyvvleaadgeealellrelr.p
00486851   1/1  --------------------sglrilivdDdpllrellallLeslgyvvltaadgeealelle....pdl
00484631   1/1  ----------------------lrilivdDdpllrellallLeklgyvvltaadgeealellrelr.pdl
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  --------------------sglrilvvdDdpllrellallLeslgyevvtaadgeealellrelerpdl
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  -----------ltllllknlrglrilvvdddplvrellrrlLerlgyevvaaadgeeale.....lrpdl
00480661   1/1  ------------------lrsklrilivdddpalrellrrlLeaegyqvlvaesgeealelleeh.rpdl
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ----------------selgrkgkivlatvggDvHdiGknlvaliLedaGfeVidlGvdvpveeiveaak


                         +         -         -         -         -         *         -:910
query           VLMDIMMPEMDGYEAMQSIRKMPEYEKIPIIALTAKAMKGDRDKCLQAGASDYISKPLDINQLLSLMRVW
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  lvllDirmPgmdGlellrrlre...lpdipvillTayadeedavraleaGaddyltKPfdleeLlaalrr
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  vllDiqmPgmdGlellrrirelellpllpdipiialtayadeedreraleagaddyltKPvsleeLlaal
00399251   1/1  aglelglrpdlvllDinmPgmdGlellrrlralpllpdipvivlTaladeedrvraleaGaddyllKPfd
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  vllDlmmPgmdGlellrrlrelpalpdipvillTalddeedrvraleaGaddyltKPfdpeeLlariral
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  gslerpdlvllDlnmPgmdGlellrrlrelpllpdipvivlTalddeedavraleagaddyllKPfdlee
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  lvllDlmmPgmdGlellrrlrelpllpdipvillTaladeedavraleagaddyllKPfdleeLlaalra
00503411   1/1  vllDimmPgmdGlellrrlrelpllpdipvillTalddeedavraleagaddyltKPfdleeLlariral
00515731   1/1  vllDimmPgmdGlellrrlre...lpdipvillTaladeedavraleagaddyllKPfdleeLlaalral
00486561   1/1  lrpdlvllDilmPgmdGlellrrlrell.lpdipvillTaladeedavraleagaddyllKPfdleeLla
00487051   1/1  lvllDlmmPgmdGlellrrlrelpllpdipvillTaladeedavraleagaddyllKPfdleeLlaalra
00472961   1/1  gdllrpdlvllDlnmPgmdGlellrrlrelpalpdipvivlTalddeedavraleagaddyltKPfdlee
00458521   1/1  vllDlmmPgmdGlellrrlrellllpdipvillTaladeedavraleagaddyllKPfdleeLlaairal
00482311   1/1  vllDimmPgmdGlellrrlrelg..pdipvillTalddeedavraleagaddyllKPfdleeLlaalral
00477991   1/1  vllDimmPgmdGlellrrlrelg..pdipvillTaladeedavraleagaddyllKPfdleeLlaalral
00464281   1/1  dlvllDimmPgmdGlellrrlrelp.lpdipvivlTaladeedavraleagaddyllKPfdleeLlaalr
00481291   1/1  vllDimmPgmdGlellrrlrelpalpdipvillTaladeedavraleagaddyllKPfdleeLlaalral
00515741   1/1  vllDlmmPgmdGlellrrlre...lpdipvivlTalddeedavraleagaddyllKPfdleeLlaalral
00509641   1/1  vllDimmPgmdGlellrrlre...lpdipvillTaladeedavraleagaddyllKPfdleeLlaalral
00518601   1/1  vllDlrmpgmdGlellrrlrell..pdipvillTayadeedavraleagaddyllKPfdleeLlaalral
00478671   1/1  vllDlrmPgmdGlellrrlrell..pdlpvillTaladeedavraleagaddyllKPfdleeLlaairal
00497611   1/1  lvllDllmPgmdGlellrrlrell..pdlpvivlTaladeedavealeagaddyllKPfdleeLlaalra
00513861   1/1  vllDlmmPgmdGlellrrlrelg..pdipvivlTaladeedavraleagaddyllKPfdleeLlaalral
00513181   1/1  vllDirmPgmdGlellrrlrell..pdipvillTayddeedavraleagaddyllKPfdleeLlaairal
00484651   1/1  vllDlmmPgmdGlellrrlrelg..pdipvillTayadeedavealeagaddyllKPfdleeLlaairal
00489751   1/1  vllDirmPgmdGlellrrlrelg..pdlpvillTayddeedavraleagaddyllKPfdleeLlaairal
00462941   1/1  vllDlrmPgmdGlellrrlrell..pdipvillTayddeedavealeagaddyllKPfdleeLlaairal
00494561   1/1  vllDllmPgmdGlellrrlrell..pdipvillTayadledavraleagaddyllKPfdleeLlaalral
00457001   1/1  dlvllDlmmPgmdGlellrrlre...lpdipvivlTalddelledavraleagaddyllKPfdleeLlaa
00456821   1/1  dlvllDlmmPgmdGlellrrlrell..pdipvivlTayddeedavraleagaddyllKpfdleeLlaair
00486851   1/1  vllDilmPgmdGlellrrlrell..pdipvillTalddeedavealeagaddyllKPfdleeLlaairal
00484631   1/1  vllDimmPgmdGlellrrlre...lpdipvillTalddeedavraleagaddyllKPfdleeLlaalral
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  lvllD.llPgmdGlellrrlrel..lpdlpvillTald..deavraleag.ddyllKPfdleeLlaalrr
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  vlldlrmpdmdglellallre...lpdlpvivltayedpelleaaleagaldylvkPldpeeLlaalela
00480661   1/1  vlldlmlPgmdglellrqLreegll..lPvilltard...drvaaldagaddyltkPfllpvdqleeLla
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  ee.dadviglsslltphldglkevleeLreagl..dipvlvGGalvsrdfaalkilglelgadayftdaf


                         -         -         -         +         -         -         -:980
query           LYRKVN----------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00435251   1/1  a---------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00462991   1/1  rrllrrle--------------------------------------------------------------
00399251   1/1  lee-------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00503421   1/1  lrrrr-----------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00477531   1/1  Lla-------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00475551   1/1  llr-------------------------------------------------------------------
00503411   1/1  lrr-------------------------------------------------------------------
00515731   1/1  lrrlr-----------------------------------------------------------------
00486561   1/1  a---------------------------------------------------------------------
00487051   1/1  llrrl-----------------------------------------------------------------
00472961   1/1  Lla-------------------------------------------------------------------
00458521   1/1  lrrr------------------------------------------------------------------
00482311   1/1  lrrr------------------------------------------------------------------
00477991   1/1  lrrlrl----------------------------------------------------------------
00464281   1/1  allr------------------------------------------------------------------
00481291   1/1  lrrlr-----------------------------------------------------------------
00515741   1/1  lrrlr-----------------------------------------------------------------
00509641   1/1  lrrrr-----------------------------------------------------------------
00518601   1/1  lrrlr-----------------------------------------------------------------
00478671   1/1  lrrlr-----------------------------------------------------------------
00497611   1/1  l---------------------------------------------------------------------
00513861   1/1  lrrlr-----------------------------------------------------------------
00513181   1/1  lrr-------------------------------------------------------------------
00484651   1/1  lrr-------------------------------------------------------------------
00489751   1/1  lrr-------------------------------------------------------------------
00462941   1/1  lrrlr-----------------------------------------------------------------
00494561   1/1  lrr-------------------------------------------------------------------
00457001   1/1  ira-------------------------------------------------------------------
00456821   1/1  all-------------------------------------------------------------------
00486851   1/1  lrr-------------------------------------------------------------------
00484631   1/1  lrrlr-----------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00518981   1/1  rll-------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00489971   1/1  lar-------------------------------------------------------------------
00480661   1/1  rid-------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00467101   1/1  ----------------------------------------------------------------------
00481351   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00501831   1/1  ----------------------------------------------------------------------
00481361   1/1  ----------------------------------------------------------------------
00356251   1/1  save------------------------------------------------------------------