[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO49907.1


[Show Plain Result]

## Summary of Sequence Search
   1::277
   1::275  7.2e-75 42.3% 0051706 00517061 1/1   lasmic binding protein-like II          
  48::271    5e-67 40.3% 0052589 00525891 1/1   lasmic binding protein-like II          
  49::277  5.2e-66 40.8% 0038704 00387041 1/1   lasmic binding protein-like II          
  49::278  5.5e-66 40.2% 0040650 00406501 1/1   lasmic binding protein-like II          
  50::277  1.8e-65 39.3% 0049318 00493181 1/1   lasmic binding protein-like II          
  43::276  9.8e-64 37.7% 0051099 00510991 1/1   lasmic binding protein-like II          
   1::277  6.8e-62 40.4% 0048727 00487271 1/1   lasmic binding protein-like II          
  53::275  4.6e-61 41.0% 0050446 00504461 1/1   lasmic binding protein-like II          
  50::271  6.4e-58 37.8% 0047371 00473711 1/1   lasmic binding protein-like II          
  52::276  6.1e-54 38.1% 0046857 00468571 1/1   lasmic binding protein-like II          
  50::274  5.2e-13 17.2% 0051090 00510901 1/1   lasmic binding protein-like II          
  59::225  8.1e-13 19.3% 0049987 00499871 1/1   lasmic binding protein-like II          
   1::277


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKRGLWFLVLVLTLALVTMGCGGGEKEKQAANQEPAKQTEKNTLDQIKEKGVIVAGLDDTFAPMGYRDE
00517061   1/1  Mkkllllllllllllalaaaa.....................dtlekikeggtlrvgtdadypPfefvde
00525891   1/1  -----------------------------------------------IkergtlrvgtdadypPfvfvdl
00387041   1/1  ------------------------------------------------kergtlrvgvdpdypPfsylde
00406501   1/1  ------------------------------------------------kergtLrvgtdpdypPfsylde
00493181   1/1  -------------------------------------------------eggtLrvgt.adypPfefvdl
00510991   1/1  ------------------------------------------LlslaaiaaagtlrvgvspdypPfsyld
00487271   1/1  Mk...................................................Lrvgt.pdypPfsylde
00504461   1/1  ----------------------------------------------------tLrvgvdpdypPfsfld.
00473711   1/1  -------------------------------------------------gsagtLrvgt.pdypPfsyl.
00468571   1/1  ---------------------------------------------------gtlrvgvdlslpyvmllep
00510901   1/1  -------------------------------------------------ekktlrigylpgpdaapl...
00499871   1/1  ----------------------------------------------------------ppktlrigtgsp


                         -         -         *         -         -         -         -:140
query           SNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQ
00517061   1/1  dgklvGfdidlakaiakrlgvkvefvpvddgkyglllngswdglipalqsgkvDlaiagltitpeRkkvv
00525891   1/1  edgklvGfdidlakalakrlgvkvefvlvedgkygllldngswdglipalqsgkaDlaiagltitpeRek
00387041   1/1  dgklvGfdvdlakalakrlgvkvefvpvswdgllpalasgkvDlaiagltitperakvvdfsapyyvsgl
00406501   1/1  dgelvGfdvdlakaiakrlgvkvefvpvdwdrllpalqsgkvDliiagltitperekvvdfsdpyytsgl
00493181   1/1  tddlltengklvGfdidlakalakrlgvkvefvlvedgkygllldlngswdglipaLqsgkaDlaiaglt
00510991   1/1  edgkltGfdvdlakalakrllgdpvkvefvpvpwdrllealasgkvDlaiagltitperekgvdfsdpyy
00487271   1/1  vlsdGkllellllndellkallllgsndllllllklllpekltGfdvdllkalakrlgvkvefvlvedgl
00504461   1/1  dgklvGfdvdlakaiakrlglkvefvpvdwdgllpalqsgkvDlaiagltitperekvvdfsdpyyssgl
00473711   1/1  edgenllltGfdvdllkaiakrlgvkvefvpvlpwdrllpalqsgkvDlliagltitperekvkkvdfsd
00468571   1/1  fsyldgngkltGfdvdllralakrlglkvelvpvpdglygglnlengswdgllgalqsGeaDlaagglti
00510901   1/1  .........elakglfkklGldvelveftdgaallealasGelDvalfgslpyllayakglpvklvavls
00499871   1/1  ggtyyplgvalakglfkellglkvevvptggsvanlealaaGevDlalvgsdpallaqagtgpfegkgap


                         +         -         -         -         -         *         -:210
query           IMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIKEVKLYKTYPEAFTDLQIGRIPVVVCDRIT
00517061   1/1  dFsdpyyesglvilvrkdskiksslfaflkplddlkgkkvgvqkgttaeeylkkllkkmlpgaklvlydd
00525891   1/1  vvdFsdpyytsglvllvrkgsplpiksledlkgkkvgvqrgsttedylkkllkelykllyelmvpgaklv
00387041   1/1  vlvvrkdspliksladLkgkrvgvvkgstyelllkkllkkpgl.kivdyddpaealaaLaaGrvDaavad
00406501   1/1  vlvvrkdspliksledLkgkrvgvvkgttyelllkkllkkpgl.kivlvddlaealqaLlaGrvDaavad
00493181   1/1  itpeRekvvdFsdpyytsglvilvrkdsdppiksledlkgkkvgvqkgstaedylkklleplykkllklk
00510991   1/1  tsglvlvvrkdsp.iksladLkgkrvgvvrgssyeelllellpdv.klvevdspeealaaLaaGrvDaav
00487271   1/1  yGslldlllslplpwdrllpalqsGkvDlaiagltitpeRekvvdfsdpyytsglvlvvrkd.spiksle
00504461   1/1  vlvvrkdnsgiksledLkgkrvgvvrgssteellkkllpdaklvlvdsleealaallsgrvdavvadspv
00473711   1/1  pyytsglvlvvrkdspldiksladlkgkrvgvvrgstyeellk.lpga.klvevdsleealeaLlagrvd
00468571   1/1  tperekvvdfsapylesglvllvrkdspllspiksledLkgkdglkvgvvrgssteeyllelllelglll
00510901   1/1  tygsalvvr..dsgikslaDLkdGkkvavpnggstsglll..allkkaGlikldplkdvklvnldpadav
00499871   1/1  ldnlravaalypeplalvvrkd.sgikslaDLkGKrvavgapGsgtellllalleaaGltpddvelvvnl


                         -         -         -         +         -         -         -:280
query           ASHYISKRADTYEIVGEKITDEPLAIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK---
00517061   1/1  ldeallaLksGrvdafvldspvlayllkknpgadlkvvgellplttegygiavrkgsp.llealn-----
00525891   1/1  lydsleealqaLlsg.vdavvgdspvllyllkknp.dlkvvgeplstegygiavrkgsp.l---------
00387041   1/1  epvlayllkkgpllalavtsdlrvlglplspeplgiavrkgdpellealnkalaklkadgeldkilk---
00406501   1/1  spvlayllkklpllglllllglvvlgeplspeplgiavrkgdpellaalnkalaelkadGtldkilek--
00493181   1/1  lpgaklvlydsleealeallsgr.dafvadspvlayllkkn.pdlkvvgeplltegygiavrkgsp.---
00510991   1/1  tdepvlayllkqlp.dlkvgvgeplsseplgiavrkgdpelldalnkalaalkadgeldkilekll----
00487271   1/1  dllLlklkgkrvvgvvrgssyeeylkellpga.klveyiklvvvdsleealaalasGrvDavvgdsp---
00504461   1/1  layllkklplddlkvvgeplsseplgiavrkgdpelldalnkalaelkedgeldkilekwfgsdl-----
00473711   1/1  avvadlpvlayllkqlplldlkvvgeplsseplgiavrkgdp.lldalnkalaalkedGel---------
00468571   1/1  ldkmipdvk.vvevdspeealealasGrvdyafvvdspvlayllkklpcdlrivgelllseplgia----
00510901   1/1  aalasgevDaavlweplddvdlavinanaaleaglrvladsldieggpslyvnvlvvrkddknp------
00499871   1/1  gpadaaaaladgkvD-------------------------------------------------------