[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO49938.1


[Show Plain Result]

## Summary of Sequence Search
   1::640
   1::150  8.7e-29 30.2% 0048604 00486041 1/1   otide-diphospho-sugar transferases      
   4::146  4.4e-27 29.6% 0050959 00509591 1/1   otide-diphospho-sugar transferases      
   1::121    5e-25 36.2% 0046833 00468331 1/1   otide-diphospho-sugar transferases      
   4::200  6.1e-21 24.0% 0042758 00427581 1/1   otide-diphospho-sugar transferases      
 200::436  8.1e-18 23.5% 0050358 00503581 1/2   ike                                     
   5::85     1e-16 40.7% 0052019 00520191 1/1   otide-diphospho-sugar transferases      
 201::383  2.5e-15 29.8% 0052100 00521001 1/2   ike                                     
 200::386  3.9e-15 21.7% 0046495 00464951 1/3   ike                                     
 384::621  1.3e-14 20.8% 0052100 00521002 2/2   ike                                     
 199::368  1.2e-13 24.8% 0047366 00473661 1/3   ike                                     
   3::85   1.1e-12 46.2% 0046778 00467781 1/1   otide-diphospho-sugar transferases      
 321::491  2.5e-12 22.7% 0040251 00402512 2/3   ike                                     
 191::305  2.8e-12 27.4% 0052646 00526461 1/3   ike                                     
 190::305  3.5e-12 25.9% 0040251 00402511 1/3   ike                                     
 195::305  5.1e-12 29.9% 0045692 00456921 1/3   ike                                     
 321::487  2.5e-11 22.8% 0042932 00429322 2/3   ike                                     
 189::304  4.2e-11 25.9% 0047256 00472561 1/3   ike                                     
 200::305  9.4e-11 26.5% 0039276 00392761 1/4   ike                                     
 321::470  1.4e-10 25.0% 0052646 00526462 2/3   ike                                     
 325::446  1.9e-10 26.9% 0051642 00516422 2/3   ike                                     
 206::471  3.9e-10 22.0% 0051037 00510371 1/2   ike                                     
 324::496  5.2e-10 17.3% 0048648 00486482 2/3   ike                                     
 162::303  1.2e-09 25.0% 0051240 00512401 1/4   ike                                     
 194::308  1.6e-09 21.6% 0052670 00526701 1/3   ike                                     
 208::313  2.4e-09 27.5% 0051642 00516421 1/3   ike                                     
 187::320  9.1e-09 19.4% 0042932 00429321 1/3   ike                                     
 386::486  1.2e-08 21.8% 0039276 00392763 3/4   ike                                     
 190::354  2.1e-08 25.7% 0046753 00467531 1/3   ike                                     
 329::459  4.1e-08 20.0% 0047832 00478322 2/3   ike                                     
 182::317  1.1e-07 23.1% 0048648 00486481 1/3   ike                                     
 199::333  2.1e-07 29.0% 0048699 00486991 1/3   ike                                     
 382::486  2.2e-07 23.1% 0051240 00512403 3/4   ike                                     
 512::626  3.3e-07 25.2% 0051240 00512404 4/4   ike                                     
 557::627  4.2e-07 28.2% 0052646 00526463 3/3   ike                                     
 324::470  4.8e-07 24.3% 0045692 00456922 2/3   ike                                     
 553::630  9.1e-07 28.0% 0051642 00516423 3/3   ike                                     
 542::631  1.8e-06 24.7% 0040251 00402513 3/3   ike                                     
 558::631  3.9e-06 27.0% 0045692 00456923 3/3   ike                                     
 340::449    4e-06 23.6% 0047256 00472562 2/3   ike                                     
 558::631  6.5e-06 28.4% 0039276 00392764 4/4   ike                                     
 190::441  7.2e-06 24.4% 0046296 00462961 1/2   in prenylyltransferase                  
 520::619    1e-05 22.0% 0048732 00487323 3/3   ike                                     
 311::488  1.1e-05 23.1% 0052670 00526702 2/3   ike                                     
 557::620  1.5e-05 30.2% 0047832 00478323 3/3   ike                                     
 107::367  3.5e-05 23.9% 0051253 00512531 1/2   ike                                     
 533::629    4e-05 25.8% 0042932 00429323 3/3   ike                                     
 212::305  4.4e-05 31.0% 0047832 00478321 1/3   ike                                     
 557::634  8.8e-05 21.8% 0047256 00472563 3/3   ike                                     
 545::632  0.00017 24.4% 0046495 00464953 3/3   ike                                     
 555::621  0.00019 24.2% 0048648 00486483 3/3   ike                                     
 272::364  0.00023 30.5% 0049644 00496442 2/4   ike                                     
 190::332  0.00034 25.9% 0046281 00462811 1/2   in prenylyltransferase                  
 555::619  0.00047 26.2% 0051037 00510372 2/2   ike                                     
 336::619  0.00061 24.6% 0046281 00462812 2/2   in prenylyltransferase                  
 552::615  0.00075 25.0% 0052670 00526703 3/3   ike                                     
 200::271   0.0019 25.0% 0049644 00496441 1/4   ike                                     
 551::626   0.0035 25.0% 0050358 00503582 2/2   ike                                     
 581::626   0.0039 28.3% 0047366 00473663 3/3   ike                                     
 383::470   0.0041 18.8% 0049644 00496443 3/4   ike                                     
 544::619    0.024 27.0% 0051253 00512532 2/2   ike                                     
 324::381    0.029 29.3% 0051240 00512402 2/4   ike                                     
 336::429    0.041 24.2% 0048699 00486992 2/3   ike                                     
 324::366    0.053 34.9% 0039276 00392762 2/4   ike                                     
 531::613    0.056 25.3% 0046753 00467533 3/3   ike                                     
 558::631      0.2 24.3% 0049644 00496444 4/4   ike                                     
 358::445     0.25 18.8% 0048732 00487322 2/3   ike                                     
 557::632     0.25 27.6% 0048699 00486993 3/3   ike                                     
 173::313     0.39 23.3% 0048732 00487321 1/3   ike                                     
 552::622     0.86 28.2% 0046296 00462962 2/2   in prenylyltransferase                  
 387::446      2.4 16.7% 0046495 00464952 2/3   ike                                     
 382::447      2.6 25.8% 0046753 00467532 2/3   ike                                     
 376::444      6.6 29.0% 0047366 00473662 2/3   ike                                     
   1::640


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGNRISLCMIVKNEEGNIRRCLASVTGVVNEIIVVDTGSTDNTCKIAREMGARIYSFEWNNNFSDARNFS
00486041   1/1  mmpkvsvviptyNeeeylertlesllaqtypdeiivvddgstdpetleileeladlrvrvirlpenlGka
00509591   1/1  ---drslpdlrpplplpplppsslpkvsviiPtyNeeleylertlesllaqtypnfllEiivvDDgStDg
00468331   1/1  maa.vsvviptynrpe.lrrtlesllaqdytyppfeiivvddgstdetleileelgakdprvrvirlp.n
00427581   1/1  ---PkvSviiptyNeekyleecleSllnQtypnfEiivvDDgStDgtleilkeyakdprirvirneldle
00503581   1/2  ----------------------------------------------------------------------
00520191   1/1  ----vsVviPayneeetigrvveslaaldypveiivvddgStDdTaelarraaaevfsrlgvevrvvlnd
00521001   1/2  ----------------------------------------------------------------------
00464951   1/3  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00473661   1/3  ----------------------------------------------------------------------
00467781   1/1  --LsllplllpllvglllllfsllllllllllrnlpvlrggrllpldlsslpkvsviIPtyNeeeylerc
00402512   2/3  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472561   1/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00512401   1/4  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00467531   1/3  ----------------------------------------------------------------------
00478322   2/3  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00512403   3/4  ----------------------------------------------------------------------
00512404   4/4  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00472562   2/3  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00462961   1/2  ----------------------------------------------------------------------
00487323   3/3  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00478323   3/3  ----------------------------------------------------------------------
00512531   1/2  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00478321   1/3  ----------------------------------------------------------------------
00472563   3/3  ----------------------------------------------------------------------
00464953   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00496442   2/4  ----------------------------------------------------------------------
00462811   1/2  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00462812   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00496441   1/4  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  ----------------------------------------------------------------------
00512532   2/2  ----------------------------------------------------------------------
00512402   2/4  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00467533   3/3  ----------------------------------------------------------------------
00496444   4/4  ----------------------------------------------------------------------
00487322   2/3  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00487321   1/3  ----------------------------------------------------------------------
00462962   2/2  ----------------------------------------------------------------------
00464952   2/3  ----------------------------------------------------------------------
00467532   2/3  ----------------------------------------------------------------------
00473662   2/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LAKATGDWILFLDADEELAGESREVLVKYVADEQVEGYFIKIINYLGKEGWTETCPDLVFRLFKNRSQYR
00486041   1/1  aarnaglkaargdyvlflDaDdildpdwlerllaaleenpdv.vvggrvrlinpdgsllrlgrrleylla
00509591   1/1  tlkeileelaakypdrirvirlpenlGkaaarnaglkaargdyilflDaDdildpdwlerllaaleenp.
00468331   1/1  pevptnprdknrylGkagarnaglkaalelpkgdyvlflDdDdilspdfle-------------------
00427581   1/1  dlsdenlGlaaarnaglklargeyiaflDaDdildpdaleklvaaleknpdvdlvggdrliidedglilg
00503581   1/2  ----------------------------------------------------------------------
00520191   1/1  gplpenpGkgaAlnt-------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00464951   1/3  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00473661   1/3  ----------------------------------------------------------------------
00467781   1/1  leslhpflnqtypnf-------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472561   1/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00512401   1/4  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00467531   1/3  ----------------------------------------------------------------------
00478322   2/3  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00512403   3/4  ----------------------------------------------------------------------
00512404   4/4  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00472562   2/3  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00462961   1/2  ----------------------------------------------------------------------
00487323   3/3  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00478323   3/3  ----------------------------------------------------------------------
00512531   1/2  ------------------------------------lylelqellkkldklknalakkellksevialrq
00429323   3/3  ----------------------------------------------------------------------
00478321   1/3  ----------------------------------------------------------------------
00472563   3/3  ----------------------------------------------------------------------
00464953   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00496442   2/4  ----------------------------------------------------------------------
00462811   1/2  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00462812   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00496441   1/4  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  ----------------------------------------------------------------------
00512532   2/2  ----------------------------------------------------------------------
00512402   2/4  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00467533   3/3  ----------------------------------------------------------------------
00496444   4/4  ----------------------------------------------------------------------
00487322   2/3  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00487321   1/3  ----------------------------------------------------------------------
00462962   2/2  ----------------------------------------------------------------------
00464952   2/3  ----------------------------------------------------------------------
00467532   2/3  ----------------------------------------------------------------------
00473662   2/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FRGAIHEQIADVILEKNKQATYRIAEDIIIIHYGYLDSQIDQKDKKNRNLHIIQKEMVENPGNYLLKYHY
00486041   1/1  rlllglglsd------------------------------------------------------------
00509591   1/1  vdlvgg----------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00427581   1/1  lsrlllplflllllllsdlsgstllfrrelleevgglllllllfdedlryaeDydlwlrl----------
00503581   1/2  -----------------------------------------------------------dPddvdallnl
00520191   1/1  ----------------------------------------------------------------------
00521001   1/2  ------------------------------------------------------------Penaealkel
00464951   1/3  -----------------------------------------------------------dpdkaeslykl
00521002   2/2  ----------------------------------------------------------------------
00473661   1/3  ----------------------------------------------------------Pigdfielspdp
00467781   1/1  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00526461   1/3  --------------------------------------------------paeellekaleldpddaeal
00402511   1/3  -------------------------------------------------iellekaleldpdnaealkll
00456921   1/3  ------------------------------------------------------kaleldpenaealknl
00429322   2/3  ----------------------------------------------------------------------
00472561   1/3  ------------------------------------------------Alaalekaleldpdnaeallnl
00392761   1/4  -----------------------------------------------------------ePkdalaylll
00526462   2/3  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00510371   1/2  -----------------------------------------------------------------egell
00486482   2/3  ----------------------------------------------------------------------
00512401   1/4  ---------------------ldpdnalallllgllllelgeleka...leayekal.lepndaealfnl
00526701   1/3  -----------------------------------------------------vsaleldpdrfeallal
00516421   1/3  -------------------------------------------------------------------yll
00429321   1/3  ----------------------------------------------yeeAielyekAlkllkksslflsl
00392763   3/4  ----------------------------------------------------------------------
00467531   1/3  -------------------------------------------------lealekwlelnPkyaealank
00478322   2/3  ----------------------------------------------------------------------
00486481   1/3  -----------------------------------------dpealfnlGlayyklgdyeeAielyekaa
00486991   1/3  ----------------------------------------------------------sieaavssdpql
00512403   3/4  ----------------------------------------------------------------------
00512404   4/4  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00472562   2/3  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00462961   1/2  -------------------------------------------------leflekalkinpKsyqaWnhR
00487323   3/3  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00478323   3/3  ----------------------------------------------------------------------
00512531   1/2  klrelyqklllldleyayakkveqllWkkvyykviellr...............................
00429323   3/3  ----------------------------------------------------------------------
00478321   1/3  ----------------------------------------------------------------------
00472563   3/3  ----------------------------------------------------------------------
00464953   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00496442   2/4  ----------------------------------------------------------------------
00462811   1/2  -------------------------------------------------lefydkalelnpknyqaWyhR
00510372   2/2  ----------------------------------------------------------------------
00462812   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00496441   1/4  -----------------------------------------------------------nPdnaelllnl
00503582   2/2  ----------------------------------------------------------------------
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  ----------------------------------------------------------------------
00512532   2/2  ----------------------------------------------------------------------
00512402   2/4  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00467533   3/3  ----------------------------------------------------------------------
00496444   4/4  ----------------------------------------------------------------------
00487322   2/3  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00487321   1/3  --------------------------------yeslleellsleelkvlkkqyekelelnpvdadtyfny
00462962   2/2  ----------------------------------------------------------------------
00464952   2/3  ----------------------------------------------------------------------
00467532   2/3  ----------------------------------------------------------------------
00473662   2/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GVELYRAERYGEAAEVLIQAANNTDSSTIYFPKLLRYIVLAYHSGGQPAKALDVIRQGLQLFPNYADLHY
00486041   1/1  ----------------------------------------------------------------------
00509591   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00503581   1/2  atvlralgrleeAetllekalrlepdyst....alenlgvlliqigeleeAlqayqraleldpndpkayl
00520191   1/1  ----------------------------------------------------------------------
00521001   1/2  GnalfklgdyeeAielytkaleldpdn....aeaylnlalaylklgdyeeAledyekaleldpdnakayy
00464951   1/3  gvalyelgdyeeAielfseaikikpk.......vlfllavayyklgkyeeAvkdldealkidpslakayl
00521002   2/2  ----------------------------------------------------------------------
00473661   1/3  vtvsletlekylllaelllnlGnelyelgkyeeAlecykrAlsllpnyleall.................
00467781   1/1  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00526461   1/3  lnlGnalfklgdyeeAielyekalelllkllgleellllddpdnle..aeallnlglaylklgdyeeAle
00402511   1/3  GnalfklgdyeeAielyekalellpellealleealeldpdnaeaylnlalaylklgdyeeAiedyekal
00456921   1/3  GnalfklgdyeeAielytkaleldpnn....aeaylnlalaylklgdyeeAledyekaleldpnnakayy
00429322   2/3  ----------------------------------------------------------------------
00472561   1/3  GlallklgrleeAlaafekaleldPd....naeawlnlGlallelgrleeAlaalekaleldpdnaealy
00392761   1/4  gllllklgdyeeAlelfekaleldpen....aealfnlalallklgdyedveeAiellekallkeldpdn
00526462   2/3  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00510371   1/2  glalqelgeyeeaiadydkaleikelldpdyaeayynrGvallslglydeAiadydkAlelnPdyaeayn
00486482   2/3  ----------------------------------------------------------------------
00512401   1/4  awallkssnlgdyeeAielleealkldpenlr...ealyylalayyklgdyekAlkylekaleldpdnlq
00526701   1/3  grallalgryeeAiaaleralalwpgdalgdldealwllaealrlep....drleallnlaeallalgry
00516421   1/3  GlallklgdyeeAielyekaleldpdn....aeallnlglallklgdyeealealglleeAieayekale
00429321   1/3  lflsskpdyeeaaeaylkaGnaykllgeyeeAleayekalelyeklgsdpdaaealynlgllykklgdye
00392763   3/4  ----------------------------------------------------------------------
00467531   1/3  glalaslgllalrlkgllllslglleevlelyleaaeinPe..nvdadvqvglGvllyllgeyeeAidcF
00478322   2/3  ----------------------------------------------------------------------
00486481   1/3  elgpadaqaylglgyllgygvlgdyekAleyykkaaelgpanaqanlgllylnglgvlkdyekAlkyyek
00486991   1/3  aeilkelGnalfkeGnyeeAillfqkalkilknyleidpedlklllelqptlllnlalahlklgeydeAv
00512403   3/4  ----------------------------------------------------------------------
00512404   4/4  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00472562   2/3  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00462961   1/2  gwllerlgrl....................................lleeelelcdkaleldprNyhaWs
00487323   3/3  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00478323   3/3  ----------------------------------------------------------------------
00512531   1/2  ....................................kalkkpnnvely..nlgalllkllkeaidfYr..
00429323   3/3  ----------------------------------------------------------------------
00478321   1/3  -ngygvkgdyeeAlelyekaaelgp......aeayynlglly..lgdyekAleyyekaae..pgnaeayy
00472563   3/3  ----------------------------------------------------------------------
00464953   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00496442   2/4  -------------------------------------------------------------nPdnaelll
00462811   1/2  gwlleklgrleealelydkaleldpknyhaWsyrgwvleklglyeealeyydkaieldpsnnsawhnrgf
00510372   2/2  ----------------------------------------------------------------------
00462812   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00496441   1/4  glalyklgdydkAlklfekalslspdraealynlpdlleslgllyyllgkyeeAialleka---------
00503582   2/2  ----------------------------------------------------------------------
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  ----------------------------------------------------------------------
00512532   2/2  ----------------------------------------------------------------------
00512402   2/4  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00467533   3/3  ----------------------------------------------------------------------
00496444   4/4  ----------------------------------------------------------------------
00487322   2/3  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00487321   1/3  awaLvkssnledveeaielLeel......................................lrlnspslr
00462962   2/2  ----------------------------------------------------------------------
00464952   2/3  ----------------------------------------------------------------------
00467532   2/3  ----------------------------------------------------------------------
00473662   2/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YGGLSLLQLKHYHKAVELFLQAVALPEQPPQYASFAGVRGFRSLYHLGEIAEVFLNYEEALRYYLESLRD
00486041   1/1  ----------------------------------------------------------------------
00509591   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00503581   1/2  nlGlvlaklkeldeAlkvyreaLelnpanaea...........lanLgnlllklgryeeAlvaydraLev
00520191   1/1  ----------------------------------------------------------------------
00521001   1/2  nlglallklgryeeAleayekaleldpdn...........aealylnlglallklgryeeAleayekale
00464951   1/3  nlGnallklgkyeeAikayekalkldpdnalalyqleaieikpdlalalnnlGllylrlgdydeAieayk
00521002   2/2  ----------------------------------------------------------------------
00473661   1/3  .....lekaieldpdlaevllnlalayyalgrydeAieclkkaleldpdn...........vkalynlal
00467781   1/1  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------iellekaleldpdnaealkllGnalfklgd
00526461   1/3  dyekaleldpdnakalynlglallk---------------------------------------------
00402511   1/3  eldpdnakalyrlglaylklgdyee---------------------------------------------
00456921   1/3  nlglallklgdyeeAledyekalel---------------------------------------------
00429322   2/3  ----------------------------------------yeeAielyekAlkllkksslflsllflssk
00472561   1/3  nlglallalgdyeeAlealekale----------------------------------------------
00392761   1/4  pealyylalalyklgdyeeAlkyfe---------------------------------------------
00526462   2/3  ----------------------------------------paeellekaleldpddaeallnlGnalfkl
00516422   2/3  --------------------------------------------yllGlallklgdyeeAielyekalel
00510371   1/2  nlGlallqlgeydeAieaydkalel...dPdyaea........ylnrGialyelgrydeAiedyekaiel
00486482   2/3  -------------------------------------------dpealfnlGlayyklgdyeeAielyek
00512401   1/4  alnllalillklgkyglageale-----------------------------------------------
00526701   1/3  deAlaaleralaldPlreralallglal------------------------------------------
00516421   1/3  ldpdnaealynlglallklgkllglallalgdy-------------------------------------
00429321   1/3  eAieayekalelypkngdfsqaakallnlaelyeellgdy------------------------------
00392763   3/4  ----------------------------------------------------------------------
00467531   1/3  ekalelnPddallwnrlGatlanlgkseeAveaYnkAl...elkPgf........vrarynlGisllnlg
00478322   2/3  ------------------------------------------------ngygvkgdyeeAlelyekaael
00486481   1/3  aaepgnaeayynlGllylkGlgvlkdyekAleyykka---------------------------------
00486991   1/3  elfrkalelqPndakaflrlglvllnlgdyeeAleyfkkaleldpsdieavsl-----------------
00512403   3/4  ----------------------------------------------------------------------
00512404   4/4  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00456922   2/3  -------------------------------------------lknlGnalfklgdyeeAielytkalel
00516423   3/3  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00472562   2/3  -----------------------------------------------------------Alaalekalel
00392764   4/4  ----------------------------------------------------------------------
00462961   1/2  yrrwvlqklglyleeeleytekli...eldpsnnsawhyRgfllkklgdlldksallilleelleeelel
00487323   3/3  ----------------------------------------------------------------------
00526702   2/3  ------------------------------vsaleldpdrfeallalgrallalgryeeAiaaleralal
00478323   3/3  ----------------------------------------------------------------------
00512531   1/2  ........................kaLqrllskydldpdnaealinlgiilqglldeaialyrkalellp
00429323   3/3  ----------------------------------------------------------------------
00478321   1/3  nlGllylkGlgvlkdyekAleyyek---------------------------------------------
00472563   3/3  ----------------------------------------------------------------------
00464953   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00496442   2/4  nlglalyklgdydkAlklfekalslspdraeal...........ynlpdlleslgllyyllgkyeeAial
00462811   1/2  llkklgrlldlelleealeyydkaieldPnnesawnylgglllklgryleal------------------
00510372   2/2  ----------------------------------------------------------------------
00462812   2/2  -------------------------------------------------------dleeelefydkalel
00526703   3/3  ----------------------------------------------------------------------
00496441   1/4  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  ----------------------------------------------------------------------
00512532   2/2  ----------------------------------------------------------------------
00512402   2/4  -------------------------------------------lyylalayyklgdyekAlkylekalel
00486992   2/3  -------------------------------------------------------eydeAvelfrkalel
00392762   2/4  -------------------------------------------lyylalalyklgdyeeAlkyfekalel
00467533   3/3  ----------------------------------------------------------------------
00496444   4/4  ----------------------------------------------------------------------
00487322   2/3  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00487321   1/3  rellYylAvayyklgdYekAlkyldllLelePd-------------------------------------
00462962   2/2  ----------------------------------------------------------------------
00464952   2/3  ----------------------------------------------------------------------
00467532   2/3  ----------------------------------------------------------------------
00473662   2/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           NPGFQPALERIIKILKPRENPEYTRECLEKVLDFSSPQATLILSNIFFQQGAYKLTLEFLERLIRMGNSS
00486041   1/1  ----------------------------------------------------------------------
00509591   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00503581   1/2  nPkflealinlgnvlvtlgdwdeAievyeravel.dPdfatayynLanvlykleefeeAldnyervlelq
00520191   1/1  ----------------------------------------------------------------------
00521001   1/2  ldpdnalayeealellekaleldpdnaeayynl-------------------------------------
00464951   1/3  kaikldprlavayvnlglaylelgdydeAlkdfeka----------------------------------
00521002   2/2  ---------------------------------PenaealkelGnalfklgdyeeAielytkaleldpdn
00473661   1/3  alyslgdyeeAieylrka----------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00402512   2/3  yeeAielyekalellpelleal.................leealeldpdnaeaylnlalaylklgdyeeA
00526461   1/3  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00429322   2/3  pdyeeaaeaylkaGnaykllgeyeeAleayekalelyeklgsdpdaaealynlgllykklgdyeeAieay
00472561   1/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00526462   2/3  gdyeeAielyekalelllkllgleellllddpdnle..............................aeal
00516422   2/3  dpdnaeallnlglallklgdyeealealglleeAieayekaleldpdnaealynlglallklgkllglal
00510371   1/2  dpndpeaylnlglallelgrle.aaeallkalellpelapayalaglnlgnlselglldeAiadyekaie
00486482   2/3  aaelgpadaqaylglgyllgygvlgdyekAleyykkaaelgpanaqanlgllylnglgvlkdyekAlkyy
00512401   1/4  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00392763   3/4  -----------------------------------ePkdalaylllgllllklgdyeeAlelfekaleld
00467531   1/3  ayee------------------------------------------------------------------
00478322   2/3  gp..aeayynlglly..lgdyekAleyyekaaepgnaeayynlGllylkGlgvlkdyekAleyyekaael
00486481   1/3  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00512403   3/4  -------------------------------ldpdnalallllgllllelgelekaleayekal.lepnd
00512404   4/4  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00456922   2/3  dpnna................................eaylnlalaylklgdyeeAledyekaleldpnn
00516423   3/3  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00472562   2/3  dpdnaeallnlGlallklgrleeAlaafekaleldPdnaeawlnlGlallelgrleeAlaalekaleldp
00392764   4/4  ----------------------------------------------------------------------
00462961   1/2  vknaifldpenesaWnylrglllllgrleealeafekalelipelldlledlgllllalilyllalelll
00487323   3/3  ----------------------------------------------------------------------
00526702   2/3  wpgda............................................lgdldealwllaealrlepdr
00478323   3/3  ----------------------------------------------------------------------
00512531   1/2  sfarallnLGdlaryrg-----------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00478321   1/3  ----------------------------------------------------------------------
00472563   3/3  ----------------------------------------------------------------------
00464953   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00496442   2/4  lekaleldPnhtea--------------------------------------------------------
00462811   1/2  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00462812   2/2  npknyqaWyhRgwlleklgrleealelydkaleldpknyhaWsyrgwvleklglyeealeyydkaieldp
00526703   3/3  ----------------------------------------------------------------------
00496441   1/4  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  --------------------------------nPdnaelllnlglalyklgdydkAlklfekalslspdr
00512532   2/2  ----------------------------------------------------------------------
00512402   2/4  dpdnlqalnllalillklgkyglagealega---------------------------------------
00486992   2/3  qPndakaflrlglvllnlgdyeeAleyfkkaleldpsdieavsllgklllrlgdiveealkvleklle..
00392762   2/4  dPdnlqalkllglila------------------------------------------------------
00467533   3/3  ----------------------------------------------------------------------
00496444   4/4  ----------------------------------------------------------------------
00487322   2/3  -------yeslleellsleelkvlkkqyekelelnpvdadtyfnyawaLvkssnledveeaielLeellr
00486993   3/3  ----------------------------------------------------------------------
00487321   1/3  ----------------------------------------------------------------------
00462962   2/2  ----------------------------------------------------------------------
00464952   2/3  ------------------------------------pkvlfllavayyklgkyeeAvkdldealkidpsl
00467532   2/3  -------------------------------ldpenaeAWlllGlalaenekeeeAiealekaleldPdn
00473662   2/3  -------------------------eclkkaleldpdnvkalynlalalyslgdyeeAieylrkaislnP


                         -         -         +         -         -         -         -:490
query           AEILFRKSFCLIQERRFLEALRILNEYTADSYIYPLAKFNQILCFWVQGKKRKVRSLVQEIRTLEPAEDT
00486041   1/1  ----------------------------------------------------------------------
00509591   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00503581   1/2  Pgnvevknriagilie------------------------------------------------------
00520191   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00464951   1/3  ----------------------------------------------------------------------
00521002   2/2  aeaylnlalaylklgdyeeAledyekaleldpdnakayynlglallklgryeeAleayekaleldpdn..
00473661   1/3  ----------------------------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00402512   2/3  iedyekaleldpdnakalyrlglaylklgdyeeAledfekaleldPdnaeallnlgllllklgdyeeAie
00526461   1/3  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00429322   2/3  ekalelypkngdfsqaakallnlaelyeellgdyeeAleyyekalelyesegddplaaeallnladl---
00472561   1/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00526462   2/3  lnlglaylklgdyeeAledyekaleldpdnakalynlglallklgdyeeA--------------------
00516422   2/3  lalgdyeeAieayekaleldpnnaea--------------------------------------------
00510371   1/2  lnpdlaeayfnlGlallklgdydeAiadykkAlelnpdnavaynnaglals-------------------
00486482   2/3  ekaaepgnaeayynlGllylkGlgvlkdyekAleyykkaaelgpanaqaylglllgngygvlgdyeeAle
00512401   1/4  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00392763   3/4  penaealfnlalallklgdyedveeAiellekallkeldpdnpealyylalalyklgdyeeAlkyf----
00467531   1/3  ----------------------------------------------------------------------
00478322   2/3  gp..aeayynlGllylkGlgvlkdlekAlkyykkaaelg-------------------------------
00486481   1/3  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00512403   3/4  aealfnlawallkssnlgdyeeAielleealkldpenlrealyylalayyklgdyekAlkylekal----
00512404   4/4  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00456922   2/3  akayynlglallklgdyeeAledyekaleldpnnaeallnlglallklgk--------------------
00516423   3/3  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00472562   2/3  dnaealynlglallalgdyeeAlealeka-----------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00462961   1/2  lilsklgkyeealellellik-------------------------------------------------
00487323   3/3  ----------------------------------------------------------------------
00526702   2/3  leallnlaeallalgrydeAlaaleralaldPlreralallglalyrlGrraeAlaayeralellpde--
00478323   3/3  ----------------------------------------------------------------------
00512531   1/2  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00478321   1/3  ----------------------------------------------------------------------
00472563   3/3  ----------------------------------------------------------------------
00464953   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00496442   2/4  ----------------------------------------------------------------------
00462811   1/2  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00462812   2/2  snnsawhnrgfllkklgrlldlelleealeyydkaieldPnnesawnylgglllkl..............
00526703   3/3  ----------------------------------------------------------------------
00496441   1/4  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  aealynlpdlleslgllyyllgkyeeAiallekaleldPnhteallnlgl--------------------
00512532   2/2  ----------------------------------------------------------------------
00512402   2/4  ----------------------------------------------------------------------
00486992   2/3  .dlatpepi-------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00467533   3/3  ----------------------------------------------------------------------
00496444   4/4  ----------------------------------------------------------------------
00487322   2/3  lnspslrrellYylAvayyklgdYe---------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00487321   1/3  ----------------------------------------------------------------------
00462962   2/2  ----------------------------------------------------------------------
00464952   2/3  akaylnlGnallklgkyeeAikayek--------------------------------------------
00467532   2/3  leallalavsltnegrleeAlealekw-------------------------------------------
00473662   2/3  dnieallllalvllklgeyseaek----------------------------------------------


                         *         -         -         -         -         +         -:560
query           ESILRLLLRSQEKRKYVHRIFLGKDAVTLLLDIVGRLLYLSELTRVEELFSRVDPKCLGDRMLDIIRLYH
00486041   1/1  ----------------------------------------------------------------------
00509591   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00520191   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00464951   1/3  ----------------------------------------------------------------------
00521002   2/2  ..........................................................aealylnlglal
00473661   1/3  ----------------------------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00402512   2/3  l---------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472561   1/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00486482   2/3  yyekal----------------------------------------------------------------
00512401   1/4  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00467531   1/3  ----------------------------------------------------------------------
00478322   2/3  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00512403   3/4  ----------------------------------------------------------------------
00512404   4/4  ---------------------ldpdnalallllgllllelgelekaleayekallepndaealfnlawal
00526463   3/3  ------------------------------------------------------------------paee
00456922   2/3  ----------------------------------------------------------------------
00516423   3/3  --------------------------------------------------------------yllGlall
00402513   3/3  ---------------------------------------------------iellekaleldpdnaealk
00456923   3/3  -------------------------------------------------------------------ayl
00472562   2/3  ----------------------------------------------------------------------
00392764   4/4  -------------------------------------------------------------------all
00462961   1/2  ----------------------------------------------------------------------
00487323   3/3  -----------------------------yeslleellsleelkvlkkqyekelelnpvdadtyfnyawa
00526702   2/3  ----------------------------------------------------------------------
00478323   3/3  ------------------------------------------------------------------llyl
00512531   1/2  ----------------------------------------------------------------------
00429323   3/3  ------------------------------------------yeeAielyekAlkllkksslflsllfls
00478321   1/3  ----------------------------------------------------------------------
00472563   3/3  ------------------------------------------------------------------lall
00464953   3/3  ------------------------------------------------------dpdkaeslyklgvaly
00486483   3/3  ----------------------------------------------------------------dpealf
00496442   2/4  ----------------------------------------------------------------------
00462811   1/2  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------egellg
00462812   2/2  ......................................................................
00526703   3/3  -------------------------------------------------------------llnlaeall
00496441   1/4  ----------------------------------------------------------------------
00503582   2/2  ------------------------------------------------------------llynlgrtli
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  ----------------------------------------------------------------------
00512532   2/2  -----------------------------------------------------lylelqellkkldklkn
00512402   2/4  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00467533   3/3  ----------------------------------------slsyeeaylfeeenpyldlenpleeGlall
00496444   4/4  -------------------------------------------------------------------aly
00487322   2/3  ----------------------------------------------------------------------
00486993   3/3  ------------------------------------------------------------------lahl
00487321   1/3  ----------------------------------------------------------------------
00462962   2/2  -------------------------------------------------------------llllgrlee
00464952   2/3  ----------------------------------------------------------------------
00467532   2/3  ----------------------------------------------------------------------
00473662   2/3  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EHGYYEKTVELLQEYIEANQNGEAHFLLAETHRELGDFIEADHHYRYAIELDPSQPRYYISQSKLYEDRS
00486041   1/1  ----------------------------------------------------------------------
00509591   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00520191   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00464951   1/3  ----------------------------------------------------------------------
00521002   2/2  lklgryeeAleayekaleldpdnalayeealellekaleldpdnaeayynlglallklgdy---------
00473661   1/3  ----------------------------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472561   1/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00512401   1/4  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00467531   1/3  ----------------------------------------------------------------------
00478322   2/3  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00512403   3/4  ----------------------------------------------------------------------
00512404   4/4  lkssnlgdyeeAielleealkldpenlrealyylalayyklgdyekAlkylekaleldpdnlqaln----
00526463   3/3  llekaleldpddaeallnlGnalfklgdyeeAielyekalelllkllgleellllddpdnleaeall---
00456922   2/3  ----------------------------------------------------------------------
00516423   3/3  klgdyeeAielyekaleldpdnaeallnlglallklgdyeealealglleeAieayekaleldpdnaeal
00402513   3/3  llGnalfklgdyeeAielyekalellpellealleealeldpdn.aeaylnlalaylklgdyeeAiedye
00456923   3/3  klgdyeeAledyekaleldpnnakayynlglallklgdyeeAledyekaleldpnnaeallnlglallkl
00472562   2/3  ----------------------------------------------------------------------
00392764   4/4  klgdyedveeAiellekallkeldpdnpealyylalalyklgdyeeAlkyfekaleldPdnlqalkllgl
00462961   1/2  ----------------------------------------------------------------------
00487323   3/3  LvkssnledveeaielLeellrlnspslrrellYylAvayyklgdYekAlkyldllLel-----------
00526702   2/3  ----------------------------------------------------------------------
00478323   3/3  kGlgvlkdyekAleyyekaaelgp.aeayynlGllylkGlgvlkdlekAlkyykkaaelg----------
00512531   1/2  ----------------------------------------------------------------------
00429323   3/3  skpdyeeaaeaylkaGnaykllgeyeeAleayekalelyeklgsdpdaaealynlgllykklgdyeeAi-
00478321   1/3  ----------------------------------------------------------------------
00472563   3/3  klgrleeAlaafekaleldPdnaeawlnlGlallelgrleeAlaalekaleldpdnaealynlglallal
00464953   3/3  elgdyeeAielfseaikikpk..vlfllavayyklgkyeeAvkdldealkidpslakaylnlGnallklg
00486483   3/3  nlGlayyklgdyeeAielyekaaelgpadaqaylglgyllgygvlgdyekAleyykkaael---------
00496442   2/4  ----------------------------------------------------------------------
00462811   1/2  ----------------------------------------------------------------------
00510372   2/2  lalqelgeyeeaiadydkaleikelldpdyaeayynrGvallslglydeAiadydkAle-----------
00462812   2/2  .........grylealleflkellelepdskyallllallllllleldeallkgdleea-----------
00526703   3/3  algrydeAlaaleralaldPlreralallglalyrlGrraeAlaayeralellpd---------------
00496441   1/4  ----------------------------------------------------------------------
00503582   2/2  eekdllealvsfeealelnPksvealynlgevlkelklyrdalelyeealeLsPenpevyvnvavv----
00473663   3/3  --------------------PigdfielspdpvtvsletlekylllaelllnlGnelyelgkyeeA----
00496443   3/4  ----------------------------------------------------------------------
00512532   2/2  alakkellksevialrqklrelyqklllldleyayakkveqllWkkvyykviellrkal-----------
00512402   2/4  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00467533   3/3  elgdleeAilafeaavqldpenaeAWlllGlalaenekeeeAiealekaleld-----------------
00496444   4/4  klgdydkAlklfekalslspdraealynlpdlleslgllyyllgkyeeAiallekaleldPnhteallnl
00487322   2/3  ----------------------------------------------------------------------
00486993   3/3  klgeydeAvelfrkalelqPndakaflrlglvllnlgdyeeAleyfkkaleldpsdieavsllgklllrl
00487321   1/3  ----------------------------------------------------------------------
00462962   2/2  aleafekalelipelldlledlgllllalilyllalellllilsklgkyeealellellikl--------
00464952   2/3  ----------------------------------------------------------------------
00467532   2/3  ----------------------------------------------------------------------
00473662   2/3  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           EKIKGEVPLE------------------------------------------------------------
00486041   1/1  ----------------------------------------------------------------------
00509591   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00520191   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00464951   1/3  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00473661   1/3  ----------------------------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472561   1/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00512401   1/4  ----------------------------------------------------------------------
00526701   1/3  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00467531   1/3  ----------------------------------------------------------------------
00478322   2/3  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00512403   3/4  ----------------------------------------------------------------------
00512404   4/4  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00402513   3/3  k---------------------------------------------------------------------
00456923   3/3  g---------------------------------------------------------------------
00472562   2/3  ----------------------------------------------------------------------
00392764   4/4  i---------------------------------------------------------------------
00462961   1/2  ----------------------------------------------------------------------
00487323   3/3  ----------------------------------------------------------------------
00526702   2/3  ----------------------------------------------------------------------
00478323   3/3  ----------------------------------------------------------------------
00512531   1/2  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00478321   1/3  ----------------------------------------------------------------------
00472563   3/3  gdye------------------------------------------------------------------
00464953   3/3  ky--------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00496442   2/4  ----------------------------------------------------------------------
00462811   1/2  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00462812   2/2  ----------------------------------------------------------------------
00526703   3/3  ----------------------------------------------------------------------
00496441   1/4  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00473663   3/3  ----------------------------------------------------------------------
00496443   3/4  ----------------------------------------------------------------------
00512532   2/2  ----------------------------------------------------------------------
00512402   2/4  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00467533   3/3  ----------------------------------------------------------------------
00496444   4/4  g---------------------------------------------------------------------
00487322   2/3  ----------------------------------------------------------------------
00486993   3/3  gd--------------------------------------------------------------------
00487321   1/3  ----------------------------------------------------------------------
00462962   2/2  ----------------------------------------------------------------------
00464952   2/3  ----------------------------------------------------------------------
00467532   2/3  ----------------------------------------------------------------------
00473662   2/3  ----------------------------------------------------------------------