[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50036.1


[Show Plain Result]

## Summary of Sequence Search
   1::240
 188::239  7.2e-12 44.2% 0046275 00462752 2/2   domain-like                             
 188::239  2.1e-11 44.2% 0045977 00459772 2/2   domain-like                             
 186::237  1.6e-08 41.2% 0035607 00356072 2/2   domain-like                             
 142::187  3.6e-07 37.2% 0036286 00362861 1/2   domain-like                             
  21::109  2.6e-06 22.5% 0047686 00476861 1/1   like cupins                             
 189::237  2.8e-06 35.4% 0036286 00362862 2/2   domain-like                             
 134::185  1.3e-05 30.8% 0035607 00356071 1/2   domain-like                             
  21::76   0.00035 23.2% 0052595 00525951 1/1   like cupins                             
  21::76   0.00037 25.0% 0050297 00502971 1/1   like cupins                             
  21::76   0.00075 21.4% 0051311 00513111 1/1   like cupins                             
 165::187       12 21.7% 0046275 00462751 1/2   domain-like                             
 165::187       26 21.7% 0045977 00459771 1/2   domain-like                             
   1::240


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDELRNILCERRIYTNSCLSHAHSFGQLLLPLQGTLFIETNLHRVRLDNKHLFFLPPGDNHTFYSKDKNE
00462752   2/2  ----------------------------------------------------------------------
00459772   2/2  ----------------------------------------------------------------------
00356072   2/2  ----------------------------------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00476861   1/1  --------------------mvllldlapdsprpvviragdlpplvepggglvrvlllfdptggglsvgl
00362862   2/2  ----------------------------------------------------------------------
00356071   1/2  ----------------------------------------------------------------------
00525951   1/1  --------------------HrHpgeevlyvleGegrvqvvggetvvlkaGDviviPpgvpHwfrntgde
00502971   1/1  --------------------HrHpddEvlyvleGsgyftvgdeegkvirveleaGDliviPaGvpHrfvn
00513111   1/1  --------------------hsHpgeellyvlsGelevtldgetyllkaGdsiyipagvpHrlrnlgdep
00462751   1/2  ----------------------------------------------------------------------
00459771   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FLVLDIPASLLPEQNYKNMDGGVYLPLDQRWESLRFLFLSETGAHSKPNPSLHDLFRYASRLLYNFDQPV
00462752   2/2  ----------------------------------------------------------------------
00459772   2/2  ----------------------------------------------------------------------
00356072   2/2  ----------------------------------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00476861   1/1  vrlppGggfppppHrHpdaeellyvleGegrltlgdggg-------------------------------
00362862   2/2  ----------------------------------------------------------------------
00356071   1/2  ---------------------------------------------------------------ddlrler
00525951   1/1  plvllv----------------------------------------------------------------
00502971   1/1  dgdepl----------------------------------------------------------------
00513111   1/1  lrllvv----------------------------------------------------------------
00462751   1/2  ----------------------------------------------------------------------
00459771   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SIQYVQNHYQEKISLEYLAALEHYNPSYYCQWFQKKTGLSPLAFIQKLRLEKAKYLLINTDFSLLRIAQE
00462752   2/2  -----------------------------------------------lRlelAkrlLletdlsiaeiAle
00459772   2/2  -----------------------------------------------lRlelAkrlLletdlsiaeiAle
00356072   2/2  ---------------------------------------------ddlrleralelleenlaedlsleel
00362861   1/2  -lelleanldeplsleelAaavglspshfsrlFkkltgltpleYlrr-----------------------
00476861   1/1  ----------------------------------------------------------------------
00362862   2/2  ------------------------------------------------rleralelleanldeplsleel
00356071   1/2  alelleenlaedlsleelAalvgfspshfsrlFkkltgltpseYr-------------------------
00525951   1/1  ----------------------------------------------------------------------
00502971   1/1  ----------------------------------------------------------------------
00513111   1/1  ----------------------------------------------------------------------
00462751   1/2  ------------------------slsaFsraFkklfgvtPseyrks-----------------------
00459771   1/2  ------------------------slsaFsraFkklfgvtPseyrkr-----------------------


                         -         -         -         +         -         -         -:280
query           VGYEQQSSLARLFRQKEGMSASDYRKAFQR----------------------------------------
00462752   2/2  lGfsslsaFsraFkklfgvtPseyrksll-----------------------------------------
00459772   2/2  lGfsslsaFsraFkklfgvtPseyrkrll-----------------------------------------
00356072   2/2  Aalvgf.spshfsrlFkkltgltpseY-------------------------------------------
00362861   1/2  ----------------------------------------------------------------------
00476861   1/1  ----------------------------------------------------------------------
00362862   2/2  Aaavgl.spshfsrlFkkltgltpleY-------------------------------------------
00356071   1/2  ----------------------------------------------------------------------
00525951   1/1  ----------------------------------------------------------------------
00502971   1/1  ----------------------------------------------------------------------
00513111   1/1  ----------------------------------------------------------------------
00462751   1/2  ----------------------------------------------------------------------
00459771   1/2  ----------------------------------------------------------------------