[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50272.1


[Show Plain Result]

## Summary of Sequence Search
   1::198
  14::185    7e-16 27.2% 0049709 00497091 1/1   al SAM enzymes                          
  14::185  1.8e-08 27.2% 0043105 00431051 1/1   al SAM enzymes                          
   1::198


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRQFIISYQIDETLYLNITNQCMNQCVFCIRETETGVGYNLWLNKEPTVEEVLDSVKNPQSYNEIVFCG
00497091   1/1  -------------aplfdlfgrppltlllevtnrCNlrCsyCyapagpglelrplvrerelsleeilrli
00431051   1/1  -------------gegltleealallrlpllellceaakcprrdrfgrrvtltllisvktngCplrCkyC


                         -         -         *         -         -         -         -:140
query           YGEPLSRLEVVKGVASKLKEMGARSIRINTNGQANKYYGHNIIPELAGLIDTMSISLNAQNATVYTEICR
00497091   1/1  delaelgvkevvltG.GEPllrpd.leelieylkelggllrvsltTNGtllt....elaeelkeagldrv
00431051   1/1  avsagsgtglkkprllspeeileeakaaaelG..vkrvvltg.gepllrpdgaeylleliraikelgle.


                         +         -         -         -         -         *         -:210
query           PADGENAYFSMLEFARKCVGVIPRVILSVVEWPGVDIEACETIAQNLGTEFRLRKPTL------------
00497091   1/1  nisldgldpethdkir....gvkgsfekvleaiellreagipvki-------------------------
00431051   1/1  itt.tngllde....elleelkeaGldrvnlslet.dpelykkir-------------------------