[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50573.1


[Show Plain Result]

## Summary of Sequence Search
   1::446
  92::296  4.9e-58 42.4% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  92::295  1.5e-54 36.0% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  89::296  1.8e-54 35.6% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  92::295  1.6e-52 38.7% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  90::295  4.5e-52 32.5% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  83::304  7.7e-49 29.0% 0037385 00373851 1/1   p containing nucleoside triphosphate hy 
 296::429  1.1e-48 58.2% 0043060 00430601 1/1   l peptide-binding domain                
 101::309    3e-44 32.2% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  95::294  5.1e-44 34.0% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  97::313  3.6e-38 31.4% 0037384 00373841 1/1   p containing nucleoside triphosphate hy 
 325::426  1.3e-37 61.8% 0042692 00426921 1/1   l peptide-binding domain                
 325::430  1.8e-37 62.0% 0045276 00452761 1/1   l peptide-binding domain                
 325::429  1.3e-36 60.6% 0038671 00386711 1/1   l peptide-binding domain                
  22::259  1.4e-36 29.6% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  76::361  2.6e-35 32.1% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
 101::317    3e-32 23.2% 0036095 00360951 1/1   p containing nucleoside triphosphate hy 
  99::356  2.4e-29 22.7% 0046842 00468421 1/1   p containing nucleoside triphosphate hy 
  98::305  3.4e-29 26.2% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 100::304  2.7e-28 25.9% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
  70::354    9e-28 34.0% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   1::94   1.9e-27 48.9% 0050537 00505371 1/1   n of the SRP/SRP receptor G-proteins    
   1::88     6e-26 46.6% 0048024 00480241 1/1   n of the SRP/SRP receptor G-proteins    
 100::293  2.4e-24 28.6% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
  88::292  2.6e-24 34.8% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  62::305  4.1e-23 27.4% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
 326::428  5.1e-23 62.3% 0036607 00366071 1/1   l peptide-binding domain                
   5::91   9.1e-23 43.7% 0043059 00430591 1/1   n of the SRP/SRP receptor G-proteins    
  68::297    1e-22 27.1% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  26::286  1.2e-22 26.0% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
  98::227  1.3e-22 30.5% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
 100::289  5.4e-22 23.6% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
   5::88   8.8e-22 41.7% 0039423 00394231 1/1   n of the SRP/SRP receptor G-proteins    
 100::253  1.3e-20 24.5% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
 100::280  7.5e-20 20.1% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  99::268  2.3e-19 24.8% 0046913 00469131 1/1   p containing nucleoside triphosphate hy 
 100::235  2.5e-18 25.0% 0048381 00483811 1/1   p containing nucleoside triphosphate hy 
  99::230  1.1e-17 23.1% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  66::356  7.7e-17 22.3% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  85::252  1.2e-16 30.6% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
  26::106    2e-16 43.5% 0043267 00432671 1/1   n of the SRP/SRP receptor G-proteins    
   1::91   9.2e-16 36.1% 0037775 00377751 1/1   n of the SRP/SRP receptor G-proteins    
  99::268  2.8e-15 24.4% 0047406 00474061 1/1   p containing nucleoside triphosphate hy 
  92::220  5.7e-15 27.8% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  93::246  8.3e-15 26.2% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  68::263    1e-14 21.7% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
  93::273  1.8e-14 24.5% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  95::287  7.6e-14 26.4% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
 101::232  1.2e-13 19.4% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  95::250  5.2e-13 24.3% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  84::288  9.4e-13 29.2% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  89::253  9.6e-13 31.4% 0036699 00366991 1/1   p containing nucleoside triphosphate hy 
  97::220  3.5e-12 24.1% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  96::220  3.6e-12 24.6% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  67::249  4.3e-12 24.6% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  97::156  1.2e-11 33.3% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  78::322    2e-11 28.8% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
 100::226  3.1e-11 30.0% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  96::220  3.4e-11 23.6% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  94::218  1.5e-10 29.7% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  95::221  1.2e-09 26.3% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
 100::205  2.2e-09 27.2% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
  99::216  3.2e-09 31.5% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  94::149  1.4e-08 34.6% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  76::202    2e-08 27.0% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
  87::192  2.1e-08 34.7% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  96::253  2.7e-08 27.2% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
  98::220  3.2e-08 28.4% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
 100::236  4.9e-08 21.0% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  99::222  7.1e-08 29.2% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  96::134  8.4e-08 46.2% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  99::221  8.7e-08 26.1% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  94::249  9.4e-08 25.0% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  99::220    1e-07 24.1% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
  85::253  1.1e-07 24.8% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  99::249  1.1e-07 30.9% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
 102::205  1.1e-07 29.0% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
 100::221  1.2e-07 25.8% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
  75::196  1.4e-07 22.4% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  96::186  1.7e-07 22.9% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  98::221  1.7e-07 24.6% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  52::219  3.5e-07 20.7% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
 101::220  3.8e-07 24.1% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
  99::221  4.8e-07 25.5% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
 100::155  4.8e-07 32.7% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  96::286  5.8e-07 26.7% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  97::143    6e-07 39.5% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  98::141  7.6e-07 41.0% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  99::223  1.1e-06 21.3% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  99::147  1.2e-06 33.3% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
 100::204  1.4e-06 23.5% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
  93::221  1.6e-06 28.7% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  99::202  1.6e-06 26.7% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  99::211  2.2e-06 27.6% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  99::147  2.4e-06 38.6% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  54::219  2.7e-06 19.3% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
  97::249  3.2e-06 23.0% 0046936 00469361 1/1   p containing nucleoside triphosphate hy 
  99::221  3.2e-06 16.3% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  97::140  3.3e-06 40.0% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  99::147  3.3e-06 37.8% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  45::219  4.1e-06 18.9% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  97::149  4.1e-06 35.4% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
 101::203  4.2e-06 21.4% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
 101::210  5.8e-06 25.5% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
  60::219  6.6e-06 17.8% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  99::205    1e-05 25.0% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
 100::218  1.2e-05 24.5% 0046459 00464591 1/1   p containing nucleoside triphosphate hy 
  43::345  1.3e-05 22.0% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  61::206  1.5e-05 25.8% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  53::226  1.7e-05 18.1% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  97::128  1.8e-05 46.9% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
 101::204  2.1e-05 28.9% 0049306 00493061 1/1   p containing nucleoside triphosphate hy 
  98::228  2.2e-05 29.9% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
 100::147  2.2e-05 41.9% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  26::88   2.7e-05 26.9% 0041903 00419031 1/1   n of the SRP/SRP receptor G-proteins    
  88::249  4.1e-05 27.1% 0037412 00374121 1/1   p containing nucleoside triphosphate hy 
  78::206  4.2e-05 22.0% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
   9::188  4.7e-05 26.3% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
  93::202  4.7e-05 28.3% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
 100::224  5.3e-05 31.1% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  92::227  6.3e-05 22.3% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
  42::209  6.5e-05 19.9% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  71::202  7.2e-05 25.4% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  96::221  7.4e-05 29.7% 0046551 00465511 1/1   p containing nucleoside triphosphate hy 
  68::233  7.7e-05 24.5% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
  97::224    9e-05 29.7% 0049292 00492921 1/1   p containing nucleoside triphosphate hy 
  93::151  9.1e-05 35.6% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
 101::142  9.6e-05 41.0% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  98::128  0.00011 44.8% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
  97::224  0.00012 23.3% 0036958 00369581 1/1   p containing nucleoside triphosphate hy 
  98::143  0.00012 48.7% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  94::125  0.00013 40.6% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  63::219  0.00014 21.2% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  99::249  0.00014 24.3% 0040239 00402391 1/1   p containing nucleoside triphosphate hy 
  99::125  0.00014 44.4% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
 101::147  0.00014 34.9% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
  94::202  0.00015 23.6% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  93::206  0.00016 27.2% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  96::224  0.00016 27.7% 0050482 00504821 1/1   p containing nucleoside triphosphate hy 
  48::203  0.00018 19.8% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  65::206   0.0002 22.2% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
  93::224   0.0002 24.6% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
 100::142   0.0002 38.5% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  79::234  0.00021 21.2% 0037955 00379551 1/1   p containing nucleoside triphosphate hy 
  98::221  0.00024 33.3% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
  55::339  0.00031 18.8% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  86::221  0.00032 29.9% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
  65::188  0.00037 24.6% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
  93::219  0.00037 23.7% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  98::227  0.00044 27.6% 0036239 00362391 1/1   p containing nucleoside triphosphate hy 
  96::227  0.00071 25.5% 0050423 00504231 1/1   p containing nucleoside triphosphate hy 
  92::148  0.00076 37.0% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
   1::446


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFKGLGERLDEIFKSLKGKGRLTEDDVNHAMREVKMALLEADVNFKVVKEFVAQVKGRAVGQDVLESLSP
00480251   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00430601   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00426921   1/1  ----------------------------------------------------------------------
00452761   1/1  ----------------------------------------------------------------------
00386711   1/1  ----------------------------------------------------------------------
00371631   1/1  ---------------------mseliiylelselewallradvgltlteaelkrlkglndlleledlski
00485451   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00468421   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00470731   1/1  ---------------------------------------------------------------------a
00505371   1/1  eeklmmferLserlskalkkllgklvldeelveelleelelaLleaDVnlkvvkdlienvkekalgeevl
00480241   1/1  lfeglskrlssalkkllglllldekdleelleelelaLleaDVgvevvkeliesvkekllgeevldglsp
00387941   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00404191   1/1  -------------------------------------------------------------vellpkvtl
00366071   1/1  ----------------------------------------------------------------------
00430591   1/1  ----LskrlssalkkllgllllsekvieelleeleeaLleaDvgvevvkklieevkekalgeevlkglkp
00439861   1/1  -------------------------------------------------------------------kle
00424711   1/1  -------------------------hskkaldelelvldnadvilevvdardpllsldvrlaellegkpr
00477561   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00394231   1/1  ----LsktlssllkkllgllllsekldeelleelelaLleaDvgvevvkklienlkekalgeevlkglkp
00509891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00477011   1/1  -----------------------------------------------------------------eelrk
00387321   1/1  ----------------------------------------------------------------------
00432671   1/1  -------------------------ldeelleelelaLleaDvgvevvkelieelkekalge........
00377751   1/1  egLektseslgdalkklllkgklde....elleeleeaLleaDvgvevtleiieelkekalgeev....k
00474061   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00467111   1/1  -------------------------------------------------------------------lge
00462761   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00471271   1/1  ------------------------------------------------------------------prai
00457311   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00437921   1/1  ---------------------------------------------------lglllveklrpkllddvvg
00515801   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00476651   1/1  -----------------------------------------------------yeplveklrpvllddlv
00469361   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00394721   1/1  --------------------------------------------lvslleslelplleklrpvllddvvg
00461621   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00420941   1/1  -----------------------------------------------------------lrpvllddvig
00468951   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00368501   1/1  ------------------------------------------kerllllelrnvllddviGqe.......
00437941   1/1  ------------------------------------------------------------lrplveklrp
00437901   1/1  ----------------------------------------------------slllvekyrpvllddvvg
00464411   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00419031   1/1  -------------------------aaplggdleelleeleeaLleaDvgveateelledlrekvree..
00374121   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00497571   1/1  --------aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkyl......pslls
00500611   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00422141   1/1  -----------------------------------------dlsleelekllelllrdllglgplvkll.
00482551   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00361211   1/1  -------------------------------------------------------------------ple
00492921   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00367291   1/1  --------------------------------------------------------------vtlddvvg
00402391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00402371   1/1  -----------------------------------------------vlektgipltkllrpvllddviG
00474201   1/1  ----------------------------------------------------------------deelel
00517691   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00521551   1/1  ------------------------------------------------------plveklrpvllddvig
00488191   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------llllla
00406781   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AQQVIKIVRDELTELLGGTQAKINLSPKPPTIIMLVGLQGAGKTTTAGKLAKLLSKQGRRPLMVAGDIYR
00480251   1/1  ---------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpy
00468601   1/1  ---------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyr
00475371   1/1  ------------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirr
00490731   1/1  ---------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyr
00448931   1/1  -------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiar
00373851   1/1  ------------rellllllllllllkgkpkviavtsgkGGvGKTTtaanLaaalaerGkkVllvdaDp.
00430601   1/1  ----------------------------------------------------------------------
00513761   1/1  ------------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDpar
00485931   1/1  ------------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadirr
00373841   1/1  --------------------------ggkpkviavtsgkGGvGKTTtaanlAaalaerGkkVllidaDp.
00426921   1/1  ----------------------------------------------------------------------
00452761   1/1  ----------------------------------------------------------------------
00386711   1/1  ----------------------------------------------------------------------
00371631   1/1  ygplsrlikllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlli
00485451   1/1  -----skiygdealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkvlvig
00360951   1/1  ------------------------------kviavtsgkGGvGKTTtaanLaaalarlGkkVllidlDpq
00468421   1/1  ----------------------------mmkviavsgKGGvGKTTtaanlAaalaelGkkVllvDlDpqg
00414121   1/1  ---------------------------kpgevvllvGpsGaGKTTLlrallgll..eglkvaviepdfge
00459701   1/1  -----------------------------MpkvillvGppGsGKTTlakaLakrlgekgvkvvvidtddl
00470731   1/1  rpltfddvvgqdeakeeleellag.....llgikkpkvillvGppGsGKTTlaralakel...gagfili
00505371   1/1  dglnpgqllikivkdeLvkllgpe----------------------------------------------
00480241   1/1  gelvikilkeeLvellgp----------------------------------------------------
00387941   1/1  -----------------------------mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpq
00410531   1/1  -----------------gelknlslelkkglkillvGlngvGKTtllkrlag..................
00404191   1/1  ddl...vgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsadelv
00366071   1/1  ----------------------------------------------------------------------
00430591   1/1  gellikivveeLvellggeke-------------------------------------------------
00439861   1/1  everistgipeldellgG.......glpkgslilitGppGsGKTtlalqlaanlaknggkvlyisleesr
00424711   1/1  llvlnKaDlldaealalllealslglgnvafksalgglg.lealldlllellkellellrlslllkkglk
00477561   1/1  ---------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlr
00478081   1/1  -----------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlr
00394231   1/1  gellikivleeLvellgp----------------------------------------------------
00509891   1/1  -----------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgr
00478131   1/1  -----------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidgddl
00469131   1/1  ----------------------------mmkviavtsgkgGvGKTtlaanlaaalaerGkrVllvdlDlp
00483811   1/1  -----------------------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldldell
00484101   1/1  ----------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigr
00477011   1/1  lldlidklrdlllsld...........lglpkvaivGrsgsGKSTLlnall......Gldvlpvgggpgt
00387321   1/1  --------------glkglllrlklelkkllkillvGlpgvGKTtllnrllg..................
00432671   1/1  ...llkilkeeLvellgpeakplll.kkkptvillv----------------------------------
00377751   1/1  dgeelieilkeeLvellgpve-------------------------------------------------
00474061   1/1  ----------------------------mmkviavtsgkGGvGKTtvaanlAaalaelGkrVlliDlDpq
00434401   1/1  ---------------------dvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfy
00508671   1/1  ----------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgs
00467111   1/1  piqlidedg.glldlldelleilseidqpvlvvaivGrpnvGKStLlNaLl...................
00462761   1/1  ----------------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgs
00374071   1/1  ------------------------lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeag
00512891   1/1  ------------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdvrs
00451571   1/1  ------------------------MsikkgeiiaivGppGsGKsTlaklLakll.....glivldgddll
00410321   1/1  -------------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp...eygptiginvg
00366991   1/1  ------------------esllkklelkkllkillvGlpgvGKTtllnrll...................
00516041   1/1  --------------------------mlkgklillvGppGsGKtTlaralaeel...glpfvvidaddl.
00472911   1/1  -------------------------mkmkkgklilltGppGsGKtTlaraLaell....gapfisgddll
00471271   1/1  lelesliksllekllellkrlslklk....kglkvalvGrpgvGKStLlnallg................
00457311   1/1  --------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddly
00503741   1/1  -------fifldlrplallplpdrlvgrdeeiealskalggaldgvslsiepggivllvGppGvGKTtLa
00480501   1/1  -----------------------------MgklillvGppGsGKtTlaralaell...g.gvvvidgddl
00478391   1/1  -------------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddll
00499331   1/1  -----------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddll
00489391   1/1  ------------------------lsikkgklivltGppGsGKtTlakaLaerl....glpvistddllr
00479331   1/1  -----------------------------apkli.ltGppGsGKttlakaLaeel....glpfidtddll
00499191   1/1  ----------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvdgllvgvvf
00533151   1/1  -----------------------MsldikkgklivltGppGsGKtTlarlLaerl....glpfistddll
00498251   1/1  -----vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsG
00513251   1/1  ----------------iellsdlslsipspevvllvGppGsGKstlakklaell.....gfilidaddlr
00444821   1/1  -------------------------elkkllkvllvGlpgvGKttllnrllggefai...ygptiginfg
00515351   1/1  ---------------------------mngklivltGppGsGKtTlaraLaerl....glpvistddllr
00477721   1/1  -----------------------------kpklilltGppGsGKttlaraLaeel....glpfidtddll
00519581   1/1  ----------------------------kpkvilltGppGvGKttlarlLakll....glpliidldala
00420081   1/1  -------------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllv------
00489631   1/1  ----------------------------MkgklillvGppGsGKtTlaraLaell...glpfiridgddl
00432181   1/1  -----------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptl
00457881   1/1  ----------------------------mgklivltGppGsGKtTlaklLaerl....glpvidtddllr
00378621   1/1  --------------glklllrrlslllkkglkvllvGlpgvGKstllnrlageef...dtpgttiginfg
00447401   1/1  ----------------------------kelkivlvGdsgvGKttLlnrllg..................
00487021   1/1  -------------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtdd
00501941   1/1  -----------------------------k.lilltGppGsGKttlaralaeel....glpfidaddllr
00482661   1/1  ----kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksn
00512061   1/1  -------------------------kkkkgklivltGppGsGKtTlakaLaerl...gglvvidtddllr
00487061   1/1  ---------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyep
00437921   1/1  qeealerlllalk.............agklphlllvGppGvGKTtlaralarlllgsgggvdvieldasd
00515801   1/1  ------------------------------llIvltGppGsGKtTlaklLaerl....glpfistddllr
00493981   1/1  ----------------------------kpklilltGppGsGKttlaraLaeel....glpfidaddllr
00496061   1/1  -----------------------------gklivltGppGsGKtTlaklLaerl....glpvistddllr
00401211   1/1  -------------------------elkrglnvgivGhvgaGKSTLlnaLlgllldtlkgelergitiki
00475381   1/1  --------------------------m.kgeiialtGpsGsGKsTlarlLagllk...ptsgivsvdglr
00498811   1/1  ---------------------------kPgkiigltGpsGsGKsTlarlLae.l....gvividgddltr
00498531   1/1  ----------------------------ldklgkildlalkileksflklevlalgvlerkeverlstGi
00496571   1/1  ----------------------------GkgelivllGpsGsGKsTlarlLagll....ggsvldtgepi
00486891   1/1  -----------------------------m.livltGppGsGKtTlakaLaerl....glpvidtddllr
00409841   1/1  ----------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpil
00510561   1/1  ----------------------------ldglgepldgllpilaklfrpievlalgllerksverlstGi
00532471   1/1  ----------------------------pGkiIvitGpsGsGKsTlarlLaellnglggi..vsvddlgr
00476071   1/1  ----------------------------kgkiigltGpsGsGKsTlaklLae.l....glpvidtddltr
00476651   1/1  gqeeakealleala............ggrpprpvllvGppGtGKTtlaralanelgrpfvpvallcfvrv
00469361   1/1  --------------------------MkkripkiaivGhpnvGKsTLlnrllgakfaigyigtvgndpgt
00533501   1/1  ----------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepig
00491901   1/1  --------------------------lmkgkiilltGppGsGKttlakaLaeel....glpfidtddllr
00457851   1/1  ----------------------------PkgklivltGppGsGKtTlakaLaerl....glpvistddll
00394721   1/1  reealeallealrr.............gpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvr
00461621   1/1  --------------------------mkg.miialtGppGsGKsTlaklLaerl....glpfistddlyr
00469161   1/1  ------------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfg
00486921   1/1  ------------------------------mlivltGppGsGKtTlakaLaerl....glpfistddllr
00420941   1/1  qeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel...gapfiridg....
00468951   1/1  ----------------------------lnvlgesidalgkilseilkllekgfltalgllerksverls
00464591   1/1  -----------------------------k.livltGppGsGKtTlakaLaerl....glpfistddllr
00368501   1/1  ..eakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaralakll...gapfiridgsel
00437941   1/1  knlddvygqeevlkalslale.....kgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidase
00437901   1/1  qeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlakalakel...gapvieida
00464411   1/1  --------------------------vkkgeiivllGpsGsGKsTlaklLagllgptg------------
00493061   1/1  ------------------------------mlIvltGppGsGKtTlakaLaerl....glpvistddllr
00484261   1/1  ---------------------------kkllkialvGhpnvGKStLlnrl....................
00482721   1/1  -----------------------------kgkiigltGpsGsGKsTlarlLae.l....glpvidtddly
00419031   1/1  .........lkealkell----------------------------------------------------
00374121   1/1  -----------------gellrlslllkkllkvvlvGlpnvGKstLlnrllggdf...depgpTiginfg
00430121   1/1  -------akeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfpsgvpfirinlselt
00497571   1/1  lldvlrpkvdfddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalak
00500611   1/1  ----------------------pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsG
00405881   1/1  -----------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlg
00372481   1/1  ---------------------dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvld
00422141   1/1  dplleeavvngasdihiepgggllrvryridgvlielifldeeellallsrlkslaglpilearlpqggr
00482551   1/1  everlstgipalDellgG.......glppgslvliaGppGsGKTtlalqlaanaalplelgklggkvlyi
00465511   1/1  -------------------------ekkrllkvalvGlpnvGKStllnallgakfai.............
00361211   1/1  llgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlldgle
00492921   1/1  --------------------------ekkirnvaivGhvnaGKtTLlnrLlgek................
00387201   1/1  ----------------------vslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvre
00480441   1/1  ------------------------------rlivllGpsGaGKsTlaklLaellp...glivisvgdttr
00464421   1/1  ---------------------------MkkgkfIvieGpdGsGKTTlaklLae.l.el------------
00369581   1/1  --------------------------kkrirnvaiiGhvdvGKsTLlnaLlgalgaivsdv.........
00426051   1/1  ---------------------------kpgevialvGpsGsGKSTlakllakel....glefidsgdilr
00480471   1/1  -----------------------sleikkgekvaivGpsGsGKSTLlnaLaglls---------------
00367291   1/1  qeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel...gapfirvdasell
00402391   1/1  ----------------------------kelkvlllGlpnvGKstllnrllggdf...depgtTigvnvg
00493431   1/1  ----------------------------kGelivllGpsGaGKsTllkllagllg---------------
00518511   1/1  ------------------------------klIvleGpsGsGKsTlaklLaekl....glpfidtddlli
00495031   1/1  -----------------------lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGK
00392701   1/1  ----------------------lslgirpgknvlLvGppGvGKTtlaralagll...gapfgrvda....
00504821   1/1  -------------------------eklrllkvalvGlpnvGKStllnallgakfai.............
00402371   1/1  qeealeallealrr.............rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvr
00474201   1/1  leklslllveklrpvllddlvgqeeakeallealr.............agrpghvllvGppGtGKTtlar
00517691   1/1  ----------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdggtlll
00493171   1/1  -----------------------------mgklivllGpsGaGKsTlaklLaekl....glivlsvgdtt
00379551   1/1  --------karlqkrkavldarlaaaleerglvlvftgnGkGkttaalglalralghglrvlvvqflkgg
00494851   1/1  ---------------------------ldllglelllslldrllllkkkllkvalvGlpgvGKStLlnal
00521551   1/1  qeeakealleal.arlkapelflslglrpgkgvlLvGppGtGKTtlaralagll...gapfvrlsas...
00488191   1/1  ---------------fllsllrrlslllkrllkvalvGlpgvGKStLlnall......gakflakvsptp
00488521   1/1  lelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGeiggkvlyv
00406781   1/1  ----------------------lslgippgknvllvGppGtGKTtlakalagel...gvpfvrisa....
00362391   1/1  ---------------------------krirnvaivGhvdvGKtTLlnaLlgllgaivgdv.........
00504231   1/1  -------------------------mkkklrnvaivGhvnvGKsTLlnrLlgelglidkdvaiverergi
00503561   1/1  ---------------------kPydrLldivgigfltaddialalgiagdsperlllalallsellgegh


                         +         -         -         -         -         *         -:210
query           PAAIKQLQVLGDQLNIPVFSMGQENPVKIAQSAVEQANSTGRDLVIIDTAGRLHINEELMDELANIKSTV
00480251   1/1  rpsapeqlgilgellgvpvvgvltgldlagalrealellllegydvvliDtagglqrglllalaladlll
00468601   1/1  aaaaerlgigavpqdvplfpsltvldnlalardlleaakaagydvvlidtaglld.ldrlvgelsggqkq
00475371   1/1  psarellgllgellgldvlvgarggdlsgglrqrlarallgdpdvlliDepgrgldpellallaelldll
00490731   1/1  paadellgvlaeelgldvllgarggdlsgglrqrlarallgdydvliiDtpgtldvllelallellkell
00448931   1/1  laareqlgivfqdpgltvlenlalgeleararellellgledydvvliDtagrlrlpselsggqkqrvai
00373851   1/1  qaslsdllglegerlpvtvidvlrgledledlivepgldllpagllaeleellasrgadeaallrellel
00430601   1/1  ----------------------------------------------------------------------
00513761   1/1  anlpeqlgidirdlidletvmelglgpngalvfaleellt.tldillealell.eedydyiliDtpGgle
00485931   1/1  igavpqlpvlfprltvlenlalggadlaeraeellellglegfdvvliDtagrgrrvgelsggqkqrvai
00373841   1/1  qaslsdllgleaedlpvpvrglldllageidledailptlvegldllpaglllaglelllelgrgpggde
00426921   1/1  ----------------------------------------------------------------------
00452761   1/1  ----------------------------------------------------------------------
00386711   1/1  ----------------------------------------------------------------------
00371631   1/1  gtDifylpa.eqlkrigllfqkglpealdveellellldlkegledilvpvlsggqkqrlalaralv...
00485451   1/1  ldifrlsarelrkrigvfqdpallphltvpenldlgllleilervlellelvgldvvlldtyphelSgGq
00360951   1/1  gpltdlllgleaeevvptladvlggeldlddvivevlegldllpaggllaglelllrgvdeaaallelld
00468421   1/1  pltdlllgleaeptlvdllageidledliledvlltglegldllpaggllpglaellrgpdeaealkell
00414121   1/1  ilidgqll...edlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilidsgGqkqrlalar
00459701   1/1  rreaikqliglglfdedgegalrrreavakllldallkalkagggdvvilDgtaltleqreallellkel
00470731   1/1  dgddlrekavgeleklgr....dlfqvaregglvpdilfideidallrkgpd.vildgag.rtpeqleal
00505371   1/1  ----------------------------------------------------------------------
00480241   1/1  ----------------------------------------------------------------------
00387941   1/1  gpslslllglegeplgladllageadledailetpegldllpaglllaglellrgerl.relleel.add
00410531   1/1  ...................gefv.dygptigvnfktvevdgvklviwDtaGqerfrsllarylrg.....
00404191   1/1  sk................lsgglqeqrvaiafalark.....pdllllDEidalgldpelqeellellde
00366071   1/1  ----------------------------------------------------------------------
00430591   1/1  ----------------------------------------------------------------------
00439861   1/1  eqlleraerlgldleellllgllsiliadplglsgeellrvllalalelkpdlliiDeltalldaer.vr
00424711   1/1  valvGlpnvGKSTLlnaLlgakvaivsdip..................................gtTrdi
00477561   1/1  ralifqdeldlfdedreegfrvpeelvrellkellarllaeggdvvilDgtnltleqrealrrllkelgr
00478081   1/1  reairelllgldlleilfeglllsdef.relleealalladg..dvvilDgfgrlldarqlleellllll
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ldldeplgvdr.erlrrvgelalllaggglcalvaddlagaleellaralaggpdviliEgagllplpli
00478131   1/1  rreavgqlglglsieeldealllpdalrralleealealkag..dvvildgfgrslaarqlllellrelg
00469131   1/1  qpslslllglepeelgladlllglvdledvllktsspgldllpaggplaglelllsealrelleel.rdd
00483811   1/1  rgllgqpklydlleellelllde.gekipveliiellkdvlvsdpdviilDelpgtnlklqdletlssva
00484101   1/1  ldldellgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilie..Gllelal
00477011   1/1  rrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielp
00387321   1/1  ...................defve.ygptiginfvtvdlkgvklqlwDtaGqerfrslwllyyrg.....
00432671   1/1  ----------------------------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  gpslslllglepeppgladllageadlddailptvvegldllpaglplagvellgperlrelleel.rgd
00434401   1/1  rpaaell..lreglgidfqlpdaldrellreevlellglgevvivdvydlsggerqraralasgpdvlil
00508671   1/1  gvvlldgddlr.........aglsiglilsdedraalrrrlgevfqelllagrlvvldgtalglelrdel
00467111   1/1  ..........gekvgfaivsgvpgtTrdiwmwivvlieldgrpllliDTpGlgdtekedekelvkialla
00462761   1/1  gvvlldgddlr.........lglligl.vfqdpdllpfltvlenvllpllaaglivivdgtlllvglrea
00374071   1/1  elgkgslllaavldsleeerer.............gitidiaavsfetdgrkitliDtPGhvdfikevir
00512891   1/1  arrgigyvfqtveellgllaelvglevrgeleellktlikelsggekqrvalarallakpdvlllDEid.
00451571   1/1  reaiglvtqdgelllelidegilvpdeiviellrealeeldadgvildgfprllgqaelllsggkadlvi
00410321   1/1  tveldgvklq...................................lwDtaGqerfrsllllylrg.....
00366991   1/1  ..................ggef.eeyvptiginfvtveikgvklqlwDtaGqerfrslwllylr......
00516041   1/1  .....lrgeelgriielfdearelvpelallfideidell.akgkvvildgtgrlleldealellg....
00472911   1/1  rglageggkpl....gllfedaleagfrqrladlirallakgkvvildgtglsreareellellkelg..
00471271   1/1  .................gdfaevgptpgtTrdikvvtvegk.gvkltliDtpGlgdpaslqeefralvlr
00457311   1/1  klsreelrklrrrigm------------------------------------------------------
00503741   1/1  kllagllkpkfgeillfgkvvyvnvsell.dlkellrlllealglpppyqlsggerlrvalaeal...la
00480501   1/1  rralvgglidgllilfledeaalselvlevllealegg..gnpdvvildgtnlleedrellrellkrl.g
00478391   1/1  relvgeggrlgrd.....lfdedrllfrellideidlllakgkvvildgtnlsealdealrrllr.....
00499331   1/1  repvig....agtdigevfqdlllaggllvddevrrlllealdelllaggkvvildgfpggllqrealrr
00489391   1/1  eavpggtd.lgelfqdl.llegellfideiaelllealaeaegkvvildgtg...ldieqrealrellle
00479331   1/1  rklv.......gesirellelagelaprillldeilellekg..givlddggrnllrallrells-----
00499191   1/1  qddfylllpalevlengaflldlllpdaldrelllelllalveglvvlldryprllsggqrqrvaia...
00533151   1/1  relvpggld-------------------------------------------------------------
00498251   1/1  sGKTtLalrllagllkpgggvvyidgeesldllrarrlgvvlqelllfpeltveenl....d--------
00513251   1/1  .....................gqkqrvalleaalke.....gylvvvDetgl------------------
00444821   1/1  tveld...................................gvklqlwDtaGqerfrslwllylrg.....
00515351   1/1  eavpggtdigelfqdyllfpfltvdeni...........rglllealeellaag.kvvildglsggllqr
00477721   1/1  relvgegielilelfdrarfrkllielldellaa.........ggvvldlgrtlllrralrellreldlv
00519581   1/1  ell..fgdvgglvvdlidleaverhlldiaeellen.....geilildeptvgldskdildelakilkev
00420081   1/1  ----------------------------------------------------------------------
00489631   1/1  lrellgellgrgigfgfqqgdlledatvlenlalllldeidkaledggvvlldgfdrsqlqrlailrall
00432181   1/1  gv...................................veldgrklvliDtpGleefasggekqrvalala
00457881   1/1  elepdgtelgellqdlllaggl.lpdaivrdlllelleelladg.kgvildgfprdleqaealrallael
00378621   1/1  tveldgvklq...................................lwDtpGqerfrsltlrylen.....
00447401   1/1  ..............................nkfivsyiptitvdiltkeveidgkrvklllwDtpGqeef
00487021   1/1  llragevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgllldrippalsgG-----
00501941   1/1  elv.......gesirelfeaagrlaprellldeidellekg.givildgfllt............lrell
00482661   1/1  rqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddl--------------
00512061   1/1  ea.....gkirelfgflgelvfralelgllldeiekllakgkvvil------------------------
00487061   1/1  vdywaavgggdllrlirelllrlgfgepdafdnellgellealleggkivlsarraqlleirlirpllae
00437921   1/1  lrgvddlreligevlqalglllgg.................kpdvlllDEidrl..dpdaqnallkllee
00515801   1/1  eavpggtpl.geeirdlldagellpdeelrdlllevirellaag.gvildgfpldleqaealrallke..
00493981   1/1  .......elvgegigllfelaeraeflillideidkllee.gkvvildgtplllea..lrellreld...
00496061   1/1  eevepggtdlgeifq-------------------------------------------------------
00401211   1/1  gaasllldklaivsdtpgttldpilgvleldg...................................pkl
00475381   1/1  lav-------------------------------------------------------------------
00498811   1/1  e---------------------------------------------------------------------
00498531   1/1  kaLDallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..rarrlgldld
00496571   1/1  rgeplge---------------------------------------------------------------
00486891   1/1  eleidgtplg..eeirdlllagellfraevrdllyelllealeaggvvldgfpldleqaellre------
00409841   1/1  gv...................................vlldgrdllllDtPGlidfaseptnlldleiie
00510561   1/1  kaLDlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql..ra--------
00532471   1/1  dvgelggaalldivd........................egrliglvfqdldllpllevlellaarleel
00476071   1/1  egvllgg---------------------------------------------------------------
00476651   1/1  ncaallel.sasdlleselfgeekeaflgallerlgklalagggtvlflDEidkl..dpdvqnaLlrlle
00469361   1/1  tr.ldsleeerergitidsglvkfelng..................lnliDtPGhedfrsltlrylr...
00533501   1/1  tplgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlaydgfpr
00491901   1/1  ----------------------------------------------------------------------
00457851   1/1  reavpgg---------------------------------------------------------------
00394721   1/1  ldlsellsvsdlvgel...................egglrglltealalakpsvlflDEidrlldardse
00461621   1/1  evvergtel-------------------------------------------------------------
00469161   1/1  tplgelirelllegfqdlilvpdllvlellaanraglrelikellaagkgvildrfplsrlay-------
00486921   1/1  eavpggtd.lgelfqellle.gellfrdelldlllevieellaag..gvildgfplslegaqalrallre
00420941   1/1  ..........sellg.....kyvgelsgglrqllalaraakpsilllDEidklapkrsptsaldadvrre
00468951   1/1  tgikaLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlr..a-----
00464591   1/1  eavlggtplg.....eeirdlleagallpdalvrdlllevikellaag..gvvldgfpldleqaellrel
00368501   1/1  tekdyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseligappgyvggdlggllteavl
00437941   1/1  lld..............pselsggerqrvliarall.....adpkvlllDEidal..dpeaqnaLl----
00437901   1/1  selrd..............vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEidal..dpdv
00464411   1/1  ----------------------------------------------------------------------
00493061   1/1  ea.vpggtelgeyirdlfdeggllllaevrelllevleealaag..gvildgfprtiesaealr------
00484261   1/1  ....................tgekvpgttgaidii.gtveldgvklnliDtpGqedfrslverylrgfle
00482721   1/1  relvagg---------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00374121   1/1  tveldgv...................................kltliDtpGqeefrsltlrylrg.....
00430121   1/1  ek.....llvselighppgyvGede.lgvlfeaarkap...psvlllDEidkl..dpdvlnaLlql----
00497571   1/1  elgrl...pfirvn................................nl----------------------
00500611   1/1  sGKTtlllqlagllapdsgeillggkvlyislee..slrrrrigmvfqelgldpdltvarer--------
00405881   1/1  vveldd..................................grqlvlvDtpGliel.aslgeglvrqalea
00372481   1/1  sleeerergitidsgavsletdg..................rkinliDtPGhedfskevlrgla......
00422141   1/1  iqavlppvvvdfrvstlpdigglslvirklreviltledlglsygdpealkdlslaippgglvlltGpt-
00482551   1/1  stee..afsperlreralslgldleelldrllvidatdlldllellerlrrllsegkvdlvv--------
00465511   1/1  ......................vedepgitidinlgveldgkvkltliDtpGlidgapellqedfralvl
00361211   1/1  isalslaerlragigyvfqdlalfpeltvlenlalg...........rarellerlglaildrlpgeLSg
00492921   1/1  ...............ldilseerergitidsaattleldgrdlllllllgklllllllslellkqlnliD
00387201   1/1  yelGeilldgr-----------------------------------------------------------
00480441   1/1  ep--------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00369581   1/1  .........adlalvldllklerergitidiglvsleld.glkitliDtPGhedflke......vlrgla
00426051   1/1  dgv-------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00367291   1/1  e......klvg.............egegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqn
00402391   1/1  tveldgvk...................................lqlwDtpGqerfrsltllylrg.....
00493431   1/1  ----------------------------------------------------------------------
00518511   1/1  aadlgfl---------------------------------------------------------------
00495031   1/1  Ttlllqlagllalglgliplggkvlyiglelt..lsperlrlraqslgldldellerllvid--------
00392701   1/1  ..........sdllg....kyvgelsgglrqr.larallakpsvlllDEidklapkrsptsgldve----
00504821   1/1  ......................vedepgitidinlgtveldgkklvliDtpGlidgaselqedfrkltlr
00402371   1/1  ldaselle.................fgkyvgafegglrqllglaraakpgvlflDEidsllga-------
00474201   1/1  alanelprslpglpfvrvnasdltdvglle.ellgkllgaat..................fllakp----
00517691   1/1  llglls.fllalvldslplerergitidvalarllldg...rkilllDtPGhedfvkevlral......r
00493171   1/1  re--------------------------------------------------------------------
00379551   1/1  wdtgelaalkrlgvdvvvlgegftwdtedreldlaaarealelakelladgeydlvvlDeltlaldlgll
00494851   1/1  l......gakflakvsptpgttidiklgvl...............................gvkltliDt
00521551   1/1  ................elvgkyvgelegglrqllalaraanpgvlflDEidklapkrsptsglddvsrrr
00488191   1/1  gttrdiktveldg.k..............................ltliDtPGlgdllviielaslledf
00488521   1/1  dqeeslfpltvlenlalggedveellerlgldlldrlphqlsggqrqr----------------------
00406781   1/1  ..........sellgkyvgelsgglrqrlalara.......adpgvlllDEidalldarsgsgsggdsss
00362391   1/1  .........allalvldslkeerergiTidigavtletd.grlitliDtPGhvdfvkevlrglrv.....
00504231   1/1  Tidialvil............................elkgrklnliDtPGhedfsslvlralrvad...
00503561   1/1  lylplddl--------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RPHEILLVVDAMTGQEAVNVADTFNQKLGLDGIVMTKLDGDARGGAALSVRKVTGTPIKFAGMGEKLDAL
00480251   1/1  vllldepllvldatagtellelakgllealgldgvvltkldlvaalgaalsvalilglpilflgtgenvd
00468601   1/1  rvaiaralaapevllldeptsgldalaellelleelgltvlvvtKlDgtakgghdlslalrladrilvlg
00475371   1/1  relradlgllvvdathdldavlkaadrilvldlggivlnkldlvakggaalelaeelgvpllsiplgegi
00490731   1/1  aelgadvvllvvdatlgleaadrilvlleglgvpgvvlNkldlvaeggaalelleelgvpilsaltgegv
00448931   1/1  aralaaplppevllldeptsgldalrellellrelgltvlvvthlDllakggadlslaleladrilvlgd
00373851   1/1  lkagdyDvviiDtppglgtlrllelpdvlglyvkglmgelkkitgvltllalaaadevllvttpetlslq
00430601   1/1  ----------------------------------------------------------------------
00513761   1/1  .lrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllseegle
00485931   1/1  arallllldpelllldEptsgldalrlllellkelgltvlvvthddgtakggaalslaleladrilvlgd
00373841   1/1  llalaalrelleaallagdyDvviiDtppglgvltllalaaalgrvvkgllalalaleileileelmeel
00426921   1/1  ----------------------------------------------------------------------
00452761   1/1  ----------------------------------------------------------------------
00386711   1/1  ----------------------------------------------------------------------
00371631   1/1  ..edpdvlilDgptalldpltrellellkelrd..lldltilvdadlev---------------------
00485451   1/1  rqRvaiaralal.........dp.dvlllDEptsglDpetralelldllrtdld................
00360951   1/1  al.eedyDyvliDtppglgdlglltlaalla.....adgvliVttpealslqdalrllelleklkdnpgl
00468421   1/1  eal.agdyDyvliDtppglhdlglltlaalla.....adlvlivttpealslqdakrllkllaklrknpg
00414121   1/1  allad.pdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDllselthdlellrelad
00459701   1/1  glpdlvvfldtpleelleRllkrlkrplpgrldrrieeiledlkgrleiyekpteplleyydkiiklidi
00470731   1/1  ldllee..........................................................lgrpvv
00505371   1/1  ----------------------------------------------------------------------
00480241   1/1  ----------------------------------------------------------------------
00387941   1/1  yDvviiDtppglgdltllalaaad........gvllVvdp..ellalraarrllellrklglpllgvvlN
00410531   1/1  .adgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlldalllrevsaelalelakelgi
00404191   1/1  laergvtlilttnnrpeeldqallrllsrldrvivldlppdleergeilkrlaeklglp...........
00366071   1/1  ----------------------------------------------------------------------
00430591   1/1  ----------------------------------------------------------------------
00439861   1/1  elrellralkrlakelgvtvilvsqltelildalagggaleql........adgvillkrdetakggrri
00424711   1/1  vlgvl....gkklvliDtPGllefaseleglgkklverflryleeadlvllVvdasdglseq........
00477561   1/1  pd..lviyldapdeell-----------------------------------------------------
00478081   1/1  eepppdlvifldadpevlleRl.lkRgrrerkddseevlellekrleryepllel....yeeadalviin
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ellrdlldlvvlvvldgivllvdaidrleaadllvlnkldlve---------------------------
00478131   1/1  rvvkpdlvifldappevlleRllkRgrgseddieeelleallrilepylrllaelperadlviinadlsl
00469131   1/1  yDyviiDtppglgdltllalaaadl........vllvttpellslrdalrllellrkl------------
00483811   1/1  ktlnfpdyvvvltvdleiilkrnlq---------------------------------------------
00484101   1/1  plilelrelsdgqiqrvapa--------------------------------------------------
00477011   1/1  glpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedandldtesdalellkelleeg
00387321   1/1  .adgillVvdatdgdsfeevaklleeilelaglenvpiilvg----------------------------
00432671   1/1  ----------------------------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  yDyviiDtppglgtltllalaaadlvllvttpellslrdalrllellekl.....glp------------
00434401   1/1  Dgptlgldvl------------------------------------------------------------
00508671   1/1  rellkeaglpllvvfldaplevlleRdrrglypeel----------------------------------
00467111   1/1  llladvvllvvdggiteqdlellklllelgkplilvlnKwDllekeeleellk-----------------
00462761   1/1  lrkll.......gllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerlee-------
00374071   1/1  glsv......adgallvvdavegefeaglsvepqtrevlllalllgvphiivviNKiDlvdadeerllei
00512891   1/1  .gldpdvleallelleelkrsg------------------------------------------------
00451571   1/1  fldaplevlleRllkrddekilkrleeqkqrvaiarallk------------------------------
00410321   1/1  .adgvllVvdatdgdsfeevkellleilelaglagvpiilvgNKiDllealgarevseelalelakelgi
00366991   1/1  gadgillVvdatdgdsfeevakwleellnlagladvpillvgn---------------------------
00516041   1/1  ..pdlvifld------------------------------------------------------------
00472911   1/1  .pvlviflda------------------------------------------------------------
00471271   1/1  ylrlrgadavllVvdatdpglfeqdlellkellelfgel-------------------------------
00457311   1/1  ----------------------------------------------------------------------
00503741   1/1  lgkpdllilDEitnlldpetlspdvlelLlrlleegkltd..............................
00480501   1/1  rpdlvifldapleell------------------------------------------------------
00478391   1/1  .pdlviflda------------------------------------------------------------
00499331   1/1  ll......--------------------------------------------------------------
00489391   1/1  lprpdlvifld-----------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00499191   1/1  ......----------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00444821   1/1  .adavllVvdatdgdsfeelkellleilellllagvpiilvgN---------------------------
00515351   1/1  vallral...------------------------------------------------------------
00477721   1/1  vfldapleelleRllkRggrfdllie--------------------------------------------
00519581   1/1  nfelifithded----------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00489631   1/1  ddp........-----------------------------------------------------------
00432181   1/1  llreadvlllvvdadeptsfldle.llellrelllagkp-------------------------------
00457881   1/1  glppdlvifl------------------------------------------------------------
00378621   1/1  .advvllvvdasdpdsfeellelleellellllagvpiilvlN---------------------------
00447401   1/1  rsllelylrg......adgvllVvdatdpesfenlkkwl-------------------------------
00487021   1/1  ----------------------------------------------------------------------
00501941   1/1  pepdlvvflda-----------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00487061   1/1  g.....kvvil-----------------------------------------------------------
00437921   1/1  l.pagvtli-------------------------------------------------------------
00515801   1/1  lglrpdlvif------------------------------------------------------------
00493981   1/1  ....lvvflda-----------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00401211   1/1  lllDtPGhedflkellralal......adgallvvdadegeflpqtlevlllllelgvkpiilvlNKiDl
00475381   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00498531   1/1  ellll.paltvee---------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00409841   1/1  allraleeadv-----------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  l---------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00476651   1/1  e.ppsnvrv-------------------------------------------------------------
00469361   1/1  ...gadgallVvdatdgvsfqtl..ellelllelgvpii-------------------------------
00533501   1/1  llsgggrqrva-----------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00394721   1/1  sslevlnaL-------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00420941   1/1  vlnaLlrll-------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00464591   1/1  .....gpr--------------------------------------------------------------
00368501   1/1  ealriklvegelgfrelerevlldlplhdasviallgggrelrdgellkalkeaeaeellellglkdlll
00437941   1/1  ----------------------------------------------------------------------
00437901   1/1  lnallklldglrdlsg------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00484261   1/1  e...adgvllVvdatedr----------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00374121   1/1  .adgvllVvdasdgdsfeevlelleellellllanvpii-------------------------------
00430121   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00405881   1/1  leradvillvvdas--------------------------------------------------------
00372481   1/1  vadgallVvdaadgvsp-----------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00465511   1/1  rylrgadgvll-----------------------------------------------------------
00361211   1/1  GqqqrvaiaralaldpdllllDe-----------------------------------------------
00492921   1/1  tPGhedfssevlra--------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00369581   1/1  vadgallVvdateg--------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00367291   1/1  aLlrlleel-------------------------------------------------------------
00402391   1/1  .adgvllVvdasdgdsfeellkwleellelllllgipii-------------------------------
00493431   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00504821   1/1  ylrgadvvllvvda--------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00517691   1/1  ladgallvvdadeg--------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00379551   1/1  dleevlelLkarpetlhvvltgrd----------------------------------------------
00494851   1/1  pGlgdldviie-----------------------------------------------------------
00521551   1/1  vlnaLlrllegledlsnvlviaatn.............................................
00488191   1/1  rslt..lrylr-----------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00406781   1/1  rrvlnaLlr-------------------------------------------------------------
00362391   1/1  .adgailVvdavegvmp-----------------------------------------------------
00504231   1/1  ...gallvvdatdgvtp-----------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EPFYPDRMADRILGMGDVLTLIEKAQANFDAEQAAKLNKKIRQADFNLEDFLEQMQQVKKLGPLEQVLGM
00480251   1/1  dlevfnpgelvdrllg------------------------------------------------------
00468601   1/1  vGeivedgtpfelle-------------------------------------------------------
00475371   1/1  ddlldfllellvsrll------------------------------------------------------
00490731   1/1  ddllefipellverl-------------------------------------------------------
00448931   1/1  Geivedgtpeellal-------------------------------------------------------
00373851   1/1  dalrllelleklglpvlgvvlNkv----------------------------------------------
00430601   1/1  ---------------GDvlsLvekaeevideeeaeelleklleskgkfdledfleqlqqlkkmGplskll
00513761   1/1  lvlelleellellpilllgvgpkdldlil-----------------------------------------
00485931   1/1  Geivedgtpeelle--------------------------------------------------------
00373841   1/1  ekivellkdpeldlvvlvttpeqlaleeakrll-------------------------------------
00426921   1/1  --------------------------------------------kfdledfleqleqlkkmGplskllgm
00452761   1/1  --------------------------------------------kfdledfleqleqlkkmGplskllgm
00386711   1/1  --------------------------------------------kfdledfleqleqlkkmGplskllgm
00371631   1/1  ----------------------------------------------------------------------
00485451   1/1  ..................kelgrtiilvthdlreae..adrilvlrkgdivelgep.qellaepklprva
00360951   1/1  pvlgvvlNkvdlrteggvleelaeelglpvlgvipld---------------------------------
00468421   1/1  lpvlgvvlNrvdprrekgaleelaeelglpvlgviprdeavreaalagkpvveldpdskaae.....ayr
00414121   1/1  rilvlgdgrivldgppvlllsaftg---------------------------------------------
00459701   1/1  dnltidevvneildllesrilgyl----------------------------------------------
00470731   1/1  viilttnrevlldralrRpgrllldepeldppdreerleilkrllkklgtvldvthddelarladr....
00505371   1/1  ----------------------------------------------------------------------
00480241   1/1  ----------------------------------------------------------------------
00387941   1/1  kvdprareellee---------------------------------------------------------
00410531   1/1  kfietSAktgeg----------------------------------------------------------
00404191   1/1  .lsdevlellaertgngrelinlle---------------------------------------------
00366071   1/1  ---------------------------------------------fdledfleqlq..............
00430591   1/1  ----------------------------------------------------------------------
00439861   1/1  liivknrggptgevplv-----------------------------------------------------
00424711   1/1  gkp.vi----------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00478081   1/1  aglsleevv-------------------------------------------------------------
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00477011   1/1  krtivvvtKiDlldkgeevldilrglliplg........lgyvpvvn.vsaltgegidelleaieeelef
00387321   1/1  ----------------------------------------------------------------------
00432671   1/1  ----------------------------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00374071   1/1  leellel---------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00410321   1/1  pvvetSAk--------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00503741   1/1  .......................kllgltliltthdldller----------------------------
00480501   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00401211   1/1  vdaell----------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00368501   1/1  rkpsqlSgGqkqRvalaralladpg.....vlflDEidklldargssggdesrervlnaLlelle-----
00437941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00521551   1/1  ...........rpeeldpallrpgRfdlvielplpdleerleilkrlleklglesdeal-----------
00488191   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IPGMGKLTKQLKDQQLDGKELAQVEAIIYSMTVWERHHPEKIDGSRKKRIARGSGTRVQDVNQLLKQFEQ
00480251   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00430601   1/1  gmlPglggllellsdlqleldekklkrleaiidsmtpkErenpellnasrkrriakGsGtsvqevnellk
00513761   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00426921   1/1  lPglgklllslaaleldekklkrleaiidsmtlkErenpellklllknasRkrriakGsGtsvqevnell
00452761   1/1  lPglgkl......leldekklkrleaiidsmtleErenpellnasrkrriakGsGtsvqevnellkqfeq
00386711   1/1  lPglgkllsel.eleldekklkrleaiidsmtlkErenpellnasrkrriakGsGtsvqevnellkqfeq
00371631   1/1  ----------------------------------------------------------------------
00485451   1/1  kkilsidl.lk-----------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00468421   1/1  elaeel----------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00470731   1/1  .gtl------------------------------------------------------------------
00505371   1/1  ----------------------------------------------------------------------
00480241   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00366071   1/1  ....................lkrleaiidsmtleerenpellnpsrrrriakGsGtsveevnellkqfkq
00430591   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00477011   1/1  flgepl----------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00432671   1/1  ----------------------------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TRKMMKQISNMTKGGKKGKMKLPFFQ--------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00430601   1/1  qfeqmkkmm-------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00426921   1/1  kqfeqm----------------------------------------------------------------
00452761   1/1  mkkmmkklgk------------------------------------------------------------
00386711   1/1  mkkmmkklg-------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00468421   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00505371   1/1  ----------------------------------------------------------------------
00480241   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00366071   1/1  mkkmmkkl--------------------------------------------------------------
00430591   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00432671   1/1  ----------------------------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------