[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50700.1


[Show Plain Result]

## Summary of Sequence Search
   1::635
   2::195  4.3e-54 40.9% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
   2::172  1.3e-46 41.7% 0049292 00492921 1/1   p containing nucleoside triphosphate hy 
   2::174  2.3e-45 41.4% 0043133 00431331 1/1   p containing nucleoside triphosphate hy 
   1::181  2.7e-44 43.9% 0036239 00362391 1/1   p containing nucleoside triphosphate hy 
   1::185  1.4e-42 37.2% 0039672 00396721 1/1   p containing nucleoside triphosphate hy 
   2::189  2.6e-42 42.5% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
   1::174  7.2e-42 39.5% 0050423 00504231 1/1   p containing nucleoside triphosphate hy 
   2::181    3e-41 43.0% 0036958 00369581 1/1   p containing nucleoside triphosphate hy 
   2::170  5.9e-41 43.4% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
   1::186  6.5e-41 41.8% 0051648 00516481 1/1   p containing nucleoside triphosphate hy 
   2::172    4e-40 42.9% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
 265::364  6.6e-36 60.0% 0050422 00504221 1/1   /eEF-1alpha/eIF2-gamma C-terminal domai 
   1::187  4.1e-35 36.6% 0046936 00469361 1/1   p containing nucleoside triphosphate hy 
   2::219  1.9e-32 29.6% 0041170 00411701 1/1   p containing nucleoside triphosphate hy 
   1::174  1.9e-31 33.3% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
   2::185  2.1e-31 31.5% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
   2::168  6.4e-30 34.8% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
   1::177  1.6e-29 32.5% 0050482 00504821 1/1   p containing nucleoside triphosphate hy 
   1::171    5e-29 31.2% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
   2::166  5.3e-29 35.7% 0051448 00514481 1/1   p containing nucleoside triphosphate hy 
   1::171  6.1e-29 32.1% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
   2::177  1.9e-28 30.5% 0046551 00465511 1/1   p containing nucleoside triphosphate hy 
   1::173  2.5e-28 31.7% 0051927 00519271 1/1   p containing nucleoside triphosphate hy 
 174::268  2.7e-28 44.2% 0049290 00492901 1/1   lation proteins                         
   2::171  3.1e-28 32.1% 0051793 00517931 1/1   p containing nucleoside triphosphate hy 
   1::169  3.2e-28 30.4% 0052859 00528591 1/1   p containing nucleoside triphosphate hy 
   1::169  3.7e-28 34.6% 0051510 00515101 1/1   p containing nucleoside triphosphate hy 
   5::169  6.8e-28 29.9% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
   2::170  2.8e-27 32.7% 0050449 00504491 1/1   p containing nucleoside triphosphate hy 
   1::171  2.9e-27 33.8% 0051582 00515821 1/1   p containing nucleoside triphosphate hy 
   4::176  5.7e-27 32.7% 0048180 00481801 1/1   p containing nucleoside triphosphate hy 
   2::173  1.9e-26 31.3% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
   4::181  4.1e-26 30.1% 0049868 00498681 1/1   p containing nucleoside triphosphate hy 
 174::265  3.1e-25 42.4% 0050420 00504201 1/1   lation proteins                         
   4::166    1e-24 30.2% 0051156 00511561 1/1   p containing nucleoside triphosphate hy 
   2::192  1.1e-24 28.0% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
 172::269  1.5e-24 42.9% 0040119 00401191 1/1   lation proteins                         
   2::170  3.5e-24 30.1% 0052054 00520541 1/1   p containing nucleoside triphosphate hy 
   2::168  9.6e-24 31.4% 0037412 00374121 1/1   p containing nucleoside triphosphate hy 
 173::268    1e-23 38.5% 0036237 00362371 1/1   lation proteins                         
 171::267  1.6e-23 41.5% 0049110 00491101 1/1   lation proteins                         
 177::270    3e-23 38.3% 0037405 00374051 1/1   lation proteins                         
 174::267  3.1e-23 43.5% 0051646 00516461 1/1   lation proteins                         
 175::269  3.4e-23 34.8% 0039670 00396701 1/1   lation proteins                         
 176::307  4.6e-23 34.1% 0037975 00379751 1/1   lation proteins                         
   1::174  1.6e-22 26.8% 0052724 00527241 1/1   p containing nucleoside triphosphate hy 
   3::182  2.9e-22 26.3% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
 174::264    3e-22 34.1% 0051767 00517671 1/1   lation proteins                         
 175::264  3.8e-22 41.1% 0046538 00465381 1/1   lation proteins                         
 171::265  6.5e-22 39.8% 0045034 00450341 1/1   lation proteins                         
 172::268  7.8e-22 36.1% 0037246 00372461 1/1   lation proteins                         
 269::368  1.3e-21 38.8% 0046254 00462541 1/1   /eEF-1alpha/eIF2-gamma C-terminal domai 
   1::183  2.7e-21 27.3% 0053196 00531961 1/1   p containing nucleoside triphosphate hy 
   4::174  3.3e-21 31.2% 0050741 00507411 1/1   p containing nucleoside triphosphate hy 
   2::171  5.8e-21 30.6% 0040239 00402391 1/1   p containing nucleoside triphosphate hy 
   1::173    6e-21 26.5% 0046392 00463921 1/1   p containing nucleoside triphosphate hy 
   4::168  1.3e-20 28.7% 0040747 00407471 1/1   p containing nucleoside triphosphate hy 
   2::168  1.6e-20 27.4% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
   2::168  2.3e-20 29.4% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
   2::170  5.5e-20 28.3% 0051104 00511041 1/1   p containing nucleoside triphosphate hy 
   2::168    7e-20 28.0% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
   2::166  9.5e-20 35.7% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
   1::168  1.4e-19 28.7% 0039999 00399991 1/1   p containing nucleoside triphosphate hy 
   1::175  2.1e-19 26.9% 0052914 00529141 1/1   p containing nucleoside triphosphate hy 
   2::168  2.4e-19 26.8% 0035786 00357861 1/1   p containing nucleoside triphosphate hy 
   2::173  2.7e-19 26.9% 0051831 00518311 1/1   p containing nucleoside triphosphate hy 
   1::171    4e-19 28.1% 0036153 00361531 1/1   p containing nucleoside triphosphate hy 
   1::171  8.7e-19 27.3% 0037045 00370451 1/1   p containing nucleoside triphosphate hy 
   2::175  9.2e-19 26.9% 0052832 00528321 1/1   p containing nucleoside triphosphate hy 
   2::165  1.3e-18 26.6% 0051458 00514581 1/1   p containing nucleoside triphosphate hy 
   5::166  1.3e-18 32.1% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
   2::168  2.9e-18 26.6% 0051562 00515621 1/1   p containing nucleoside triphosphate hy 
   1::177  4.3e-18 28.7% 0051832 00518321 1/1   p containing nucleoside triphosphate hy 
   1::172  8.2e-18 26.7% 0049269 00492691 1/1   p containing nucleoside triphosphate hy 
   1::171  9.3e-18 26.7% 0051472 00514721 1/1   p containing nucleoside triphosphate hy 
   2::177  9.3e-18 25.1% 0051704 00517041 1/1   p containing nucleoside triphosphate hy 
   4::171  1.1e-17 25.6% 0051450 00514501 1/1   p containing nucleoside triphosphate hy 
   2::170  1.3e-17 27.3% 0052841 00528411 1/1   p containing nucleoside triphosphate hy 
   1::173  1.9e-17 26.5% 0052502 00525021 1/1   p containing nucleoside triphosphate hy 
   2::181  2.3e-17 27.6% 0052879 00528791 1/1   p containing nucleoside triphosphate hy 
   2::171  2.4e-17 26.9% 0044990 00449901 1/1   p containing nucleoside triphosphate hy 
 439::511  2.5e-17 37.0% 0048041 00480411 1/1   ed helix" DNA-binding domain            
   2::173  3.5e-17 29.2% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
   1::173  3.8e-17 27.3% 0048154 00481541 1/1   p containing nucleoside triphosphate hy 
   2::170    4e-17 25.6% 0051471 00514711 1/1   p containing nucleoside triphosphate hy 
   3::169  5.2e-17 27.5% 0052098 00520981 1/1   p containing nucleoside triphosphate hy 
   1::180  7.1e-17 23.9% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
   1::170  9.2e-17 23.8% 0051462 00514621 1/1   p containing nucleoside triphosphate hy 
   2::173  9.5e-17 24.2% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
   1::170    1e-16 24.4% 0035814 00358141 1/1   p containing nucleoside triphosphate hy 
   2::172    1e-16 29.2% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
 174::271  1.3e-16 28.1% 0036231 00362311 1/1   lation proteins                         
   2::174  1.4e-16 23.0% 0051952 00519521 1/1   p containing nucleoside triphosphate hy 
   2::176  2.1e-16 29.3% 0044233 00442331 1/1   p containing nucleoside triphosphate hy 
   2::172  2.8e-16 28.0% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
   1::168  2.9e-16 22.9% 0052680 00526801 1/1   p containing nucleoside triphosphate hy 
   2::168  2.9e-16 26.9% 0044416 00444161 1/1   p containing nucleoside triphosphate hy 
   2::172  3.7e-16 28.6% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
   4::171  3.7e-16 27.0% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
   2::176    4e-16 25.9% 0052002 00520021 1/1   p containing nucleoside triphosphate hy 
   1::177  5.5e-16 24.7% 0050792 00507921 1/1   p containing nucleoside triphosphate hy 
   2::178  5.8e-16 26.1% 0052785 00527851 1/1   p containing nucleoside triphosphate hy 
   2::170  8.4e-16 31.9% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
   1::177    1e-15 23.6% 0052615 00526151 1/1   p containing nucleoside triphosphate hy 
   3::168  1.1e-15 25.2% 0036279 00362791 1/1   p containing nucleoside triphosphate hy 
   2::197  1.5e-15 25.5% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
   2::168  2.6e-15 25.5% 0036699 00366991 1/1   p containing nucleoside triphosphate hy 
   1::168  2.9e-15 23.6% 0051461 00514611 1/1   p containing nucleoside triphosphate hy 
   2::177  4.9e-15 22.6% 0035281 00352811 1/1   p containing nucleoside triphosphate hy 
   1::168  8.2e-15 26.2% 0038731 00387311 1/1   p containing nucleoside triphosphate hy 
   1::168  1.2e-14 24.8% 0041234 00412341 1/1   p containing nucleoside triphosphate hy 
 578::637  3.4e-14 50.0% 0040682 00406821 1/1   ed helix" DNA-binding domain            
   2::172  3.7e-14 22.6% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
 512::575  5.3e-14 35.9% 0048042 00480422 2/2   ed helix" DNA-binding domain            
   1::178  6.1e-14 22.2% 0052625 00526251 1/1   p containing nucleoside triphosphate hy 
   2::173    2e-13 22.7% 0052528 00525281 1/1   p containing nucleoside triphosphate hy 
 265::358  2.5e-13 29.3% 0036957 00369571 1/1   /eEF-1alpha/eIF2-gamma C-terminal domai 
   1::181  4.2e-13 24.2% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   1::172    5e-13 23.1% 0050775 00507751 1/1   p containing nucleoside triphosphate hy 
   1::171  6.4e-13 24.1% 0051460 00514601 1/1   p containing nucleoside triphosphate hy 
   2::174  6.5e-13 22.2% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
   1::171  9.5e-13 24.1% 0051459 00514591 1/1   p containing nucleoside triphosphate hy 
   2::170  1.3e-12 22.4% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
   1::172  1.8e-12 21.7% 0052735 00527351 1/1   p containing nucleoside triphosphate hy 
   2::171  2.2e-12 24.7% 0048113 00481131 1/1   p containing nucleoside triphosphate hy 
   2::171  3.3e-12 24.5% 0045559 00455591 1/1   p containing nucleoside triphosphate hy 
   1::123  6.4e-12 28.6% 0049759 00497591 1/1   p containing nucleoside triphosphate hy 
   2::170  8.2e-12 26.4% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
 153::274  9.2e-12 22.2% 0052053 00520531 1/1   lation proteins                         
   2::175  9.9e-12 23.8% 0052501 00525011 1/1   p containing nucleoside triphosphate hy 
   1::174  1.1e-11 24.1% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 135::272  1.4e-11 23.4% 0048252 00482521 1/1   lation proteins                         
 171::275  1.6e-11 22.2% 0050448 00504481 1/1   lation proteins                         
   1::178  1.8e-11 23.8% 0052005 00520051 1/1   p containing nucleoside triphosphate hy 
   1::174  4.1e-11 23.0% 0049404 00494041 1/1   p containing nucleoside triphosphate hy 
 269::358  7.6e-11 28.2% 0037247 00372471 1/1   /eEF-1alpha/eIF2-gamma C-terminal domai 
   2::171  1.5e-10 20.6% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   2::175    3e-09 31.4% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   6::174  4.7e-09 23.3% 0052764 00527641 1/1   p containing nucleoside triphosphate hy 
   2::164  3.6e-07 23.7% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
   1::174  4.3e-06 20.1% 0049582 00495821 1/1   p containing nucleoside triphosphate hy 
  58::189  0.00012 21.7% 0036095 00360951 1/1   p containing nucleoside triphosphate hy 
  68::168   0.0002 24.5% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
 372::424       90 18.9% 0048042 00480421 1/2   ed helix" DNA-binding domain            
   1::635


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKHIIIGTAGHVDHGKTLLIKTLTGMDTDRLKEEKERGISIELGFAQLKLPSGKQAGIVDVPGHEKFIKN
00374071   1/1  -lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeagelgkgslllaavldsleeererg
00492921   1/1  -ekkirnvaivGhvnaGKtTLlnrLlgekldilseerergitidsaattleldgrdlllllllgklllll
00431331   1/1  -ledlldlllllllllllslllkrilniaiiGhvdaGKsTLlnallgltgaiseagavklgkealelgkg
00362391   1/1  krirnvaivGhvdvGKtTLlnaLlgllgaivgdvallalvldslkeerergiTidigavtletd.grlit
00396721   1/1  krllnvaivGhvdvGKSTLlnrLlgdsgaiveagtvkdgkvlallgkgsfllllvldsldeerergitid
00372481   1/1  -dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvldsleeerergitidsgavsle
00504231   1/1  mkkklrnvaivGhvnvGKsTLlnrLlgelglidkdvaiverergiTidialvilelk.grklnliDtPGh
00369581   1/1  -kkrirnvaiiGhvdvGKsTLlnaLlgalgaivsdvadlalvldllklerergitidiglvsleld.glk
00401211   1/1  -elkrglnvgivGhvgaGKSTLlnaLlgllldtlkgelergitikigaasllldklaivsdtpgttldpi
00516481   1/1  lkllelkrirniaiiGhvdaGKsTLlnrLlgetgaidedlllklevlakklgevddglllaivldklele
00517691   1/1  -lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdggtlllllgllsfllalvldslplere
00504221   1/1  ----------------------------------------------------------------------
00469361   1/1  MkkripkiaivGhpnvGKsTLlnrllgakfaigyigtvgndpgttrldsleeerergitidsglvkfeln
00411701   1/1  -kfslelllalmldlerirniaiiGhvdaGKTTLterLlyytgiiseagevdltvtDtledEreRgiTik
00494851   1/1  ldllglelllslldrllllkkkllkvalvGlpgvGKStLlnallgak.flakvsptpgttidiklgvl..
00471271   1/1  -prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallg..gdfaevgptpgtT
00484261   1/1  -kkllkialvGhpnvGKStLlnrltgekv........pgttgaidii.gtveldg.vklnliDtpGqedf
00504821   1/1  eklrllkvalvGlpnvGKStllnallgakfai..vedepgitidinlgtveld.gkklvliDtpGlidga
00523461   1/1  ak...valvGlpnvGKStLlnallgdk...aivsdipgitrdiqtgtle.....kltliDtpGllltkll
00514481   1/1  -alllslllkkllkvalvGlpnvGKstllnrllg......gkfseygtTidinfgtveldg.vklvlvDt
00488191   1/1  fllsllrrlslllkrllkvalvGlpgvGKStLlnallgak.flakvsptpgttrdik..tveldg..klt
00465511   1/1  -ekkrllkvalvGlpnvGKStllnallgakfai..vedepgitidinlg.veldgkvkltliDtpGlidg
00519271   1/1  sllsslllkkllkvalvGlpnvGKstllnrll......ggkfseygtTiginfgtveldg.vklvlvDtp
00492901   1/1  ----------------------------------------------------------------------
00517931   1/1  -kkllkvalvGlpnvGKstllnrllgdkv.....sdepgtTidinfgtveldg.vkltlvDtpGqerfrs
00528591   1/1  sallllllelkkllkvalvGlpnvGKstLlnrll......ggkfseygtTiginfgtveldg.vkltlvD
00515101   1/1  pleelllslllkkllkvalvGlpnvGKstllnrllggkf....vereptitidi..gtveldg.vkltlv
00526911   1/1  ----rkvalvGlpnvGKStLlnrllgak.....vse.pgtTiginfgtvelk.dgklvkltliDtpGqed
00504491   1/1  -rirniaiighvdaGKTTlteaLllytgaiskagevkdgaavlDwmelEkergitikssavslew.kgyl
00515821   1/1  glllllllslelkkllkvalvGlpnvGKstLlnrll......gakfvsrgpTiginlgtveld.gvkltl
00481801   1/1  ---akialvGlpnvGKStllnallga..dfaivedtpgttidinlgvveldg.vkltliDtpGlidgase
00409841   1/1  -lslelkkglkvalvGrpgvGKSTLlnaLlgad..laivsdipgttrdpilgvvll.dgrdllllDtPGl
00498681   1/1  ---llkvalvGlpnvGKStllnallg...dkfivsnipgitidpnvgtveldgkvkltliDtpGlidpas
00504201   1/1  ----------------------------------------------------------------------
00511561   1/1  ---lkvalvGlpnvGKStllnallgadf..aiventpgttidiklvvvelk.gvklvliDtpGlidgale
00414001   1/1  -rrlllelkmllrvgivGlpNvGKSTLfnaLt..gakvaivanypftTldpnlgvvelpderldllagla
00401191   1/1  ----------------------------------------------------------------------
00520541   1/1  -ldlerirniaiiahvdaGKTtltealllytgaiskagevddgaavlDwmelEreRgitikssavsley.
00374121   1/1  -gellrlslllkkllkvvlvGlpnvGKstLlnrllggdf......depgpTiginfgtveldg.vkltli
00362371   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00527241   1/1  mselkllkvvlvGrpnvGKstLlnrllg...gk.fvedypgttgdfllktveldgklvklqlwDtpGqer
00405881   1/1  --gervglvGrpgaGKSTLlnaltglk...aivsgypgttldpnlgvvelddgrqlvlvDtpGlielasl
00517671   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00462541   1/1  ----------------------------------------------------------------------
00531961   1/1  kkllkvvlvGdpnvGKstLlnrllg...gkf.vsdypgttgdfivktveld.gktvklqlwDtpGqerfr
00507411   1/1  ---lkvalvGlPNvGKSTLfnaltgak...aivanypftTrdpnlgvvevdderldllaelslkpalgvk
00402391   1/1  -kelkvlllGlpnvGKstllnrllggdf......depgtTigvnvgtveldg.vklqlwDtpGqerfrsl
00463921   1/1  lkllkvvlvGdpnvGKssLlnrllg.gk...fvsdypgttrdfivktveldgklvklqlwDtpGqerfrs
00407471   1/1  ---lkvllvGlpnvGKsTLlnrllgdkv......dkpgtTiginlgtveldg.vkltlvDtpGqerfrsl
00447401   1/1  -kelkivlvGdsgvGKttLlnrllgnk...fivsyiptitvdiltkevei.dgkrvklllwDtpGqeefr
00517841   1/1  -hgegirdlldlidelrdllerldldlpkiavvGrpnvGKSsLlnallgrdflpvssgpgTtrptelrlg
00511041   1/1  -ekkllkvvlvGrpnvGKstLlnrllg....gkfvedypgttgdfllktveldgkkvklqlwDtpGqerf
00378621   1/1  -kglkvllvGlpgvGKstllnrlageef......dtpgttiginfgtveldg.vklqlwDtpGqerfrsl
00424711   1/1  -hskkaldelelvldnadvilevvdardpllsldvrlaellegkprllvlnKaDlldaealalllealsl
00399991   1/1  kkelkvvlvGdpgvGKstLlnrllgge....fvedypgttgdflvktvel.dgktvkltlwDtpGqeefr
00529141   1/1  l..lkvalvGrpnvGKstLl.rllg...gkfvedypgtigdfivgtvel...dgklvklqlwDtpGqerf
00357861   1/1  -kkdklfkillvGdsgvGKTtLlnrllg...deflveyiptigidfytktveidgkkvklqiwDtaGqer
00518311   1/1  -gelkvvlvGdpnvGKssLlnrllg...gkfvedypgttgdtil.ktveld.gklvklqlwDtpGqerfr
00361531   1/1  kkllkivlvGdpgvGKstllnrllgne....fvedypgttgdlivktveldgkkvklnliDtpGqeefrs
00370451   1/1  kkllkillvGdpgvGKstLlnrllg...defiveyiptitvdfltktvel.dgklvklqlwDtaGqerfr
00528321   1/1  -dkllkvvlvGdpnvGKssLlnrllg...gkfivsyiptiltldfivktvel.dgkkvtllllqiwDtpG
00514581   1/1  -kelkvvlvGrpnvGKssLlnrllg...gkfivsyiptitrdfilktveld.gkkvklqlwDtaGqerfr
00477011   1/1  ----eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrl
00515621   1/1  -kelkvlllGlsgvGKTtllnrllggef.....leeygpTigvnfvtvdlkd.vklqlwDtaGqerfrsl
00518321   1/1  msslelkkllkvvlvGdpnvGKstLlnrllggkf....vsdypgttvdfnvktveldgkkvklqlwDtpG
00492691   1/1  GlkkllkvvlvGdpnvGKStLlnrllggk....fvsdypgttrdfnvktveld.gklvkltlwDtpGqer
00514721   1/1  lskkelkvvlvGdpnvGKssLlnrllg...gkfvsdypgttgdni.lktveld.gklvklqlwDtpGqer
00517041   1/1  -kkllkvvlvGdpnvGKstLlnrllg...dkfivsyiptitrdfllktvel.dgklvklqlwDtpGqerf
00514501   1/1  ---lkvvlvGrpnvGKstLlnrllg...gkfivsyiptitldfllktveldgkevklqlwDtpGqerfrs
00528411   1/1  -sllkkllkvvlvGrpnvGKstLlnrllg..gkfaivsyiptitldfllgtveldgkkvklvlwDtpGqe
00525021   1/1  eldkllkvvlvGdpnvGKssLlnrllg....dvfvsdypgttgdflvktveld.gklvklqlwDtpGqer
00528791   1/1  -kkkllkvvlvGdpnvGKstLlnrllg...gkf.vsdypgttrdfnlktveld.gklvklqlwDtpGqer
00449901   1/1  -kllkillvGdsgvGKStLlnrllg...gkfivsyiptitvdiltktvel.dgkkvkltlwDtpGqeefr
00480411   1/1  ----------------------------------------------------------------------
00432181   1/1  -kglkvalvGrpgvGKStLlnallglk..vaivsdypgttrdptlgvveldgr.klvliDtpGleefasg
00481541   1/1  glkkllkvvlvGdpnvGKstLlnrllg....gvfvsdypgttgdfivktveld.gklvklqlwDtpGqer
00514711   1/1  -kelkvvlvGdpgvGKtsllnrllg...defiveyiptigvdfltktvev.dgktvklqlwDtaGqerfr
00520981   1/1  --glkvvlvGdpnvGKstLlnrllg....gvfvsdypgttgdfivktveld.gkkvklqlwDtpGqerfr
00470231   1/1  elaellsllierlllrdlllelkllkvllvGdpnvGKStLlnrl........kivsdpgtTigv.vgtve
00514621   1/1  lkkllkvvlvGdsgvGKtsLlnrllg...gefiveyiptigvdfytktvev.dgkkvklqlwDtaGqerf
00403151   1/1  -kglkivlvGdsgvGKTtLlnrllg...defpvsyiptigvdfyvktveidgkklvkltlwDtaGqerfr
00358141   1/1  kkelkvllvGdsgvGKstLlnrllgge...fvedyapttgddi..tktveldgkkvkltlwDtaGqerfr
00410321   1/1  -kglkilllGlngaGKTTllnrllggefp......eygptiginvgtveldg.vklqlwDtaGqerfrsl
00362311   1/1  ----------------------------------------------------------------------
00519521   1/1  -kelkilllGlpnvGKstllnrllgeef......dkpgpTrgvnvgtvei.ggvkfrlwDtgGqrrfrkl
00442331   1/1  -kkkllkivlvGdpgvGKstLlnrllg...de.fvedyagttgdnivktvel.dgkkvklnlwDtpGqed
00444821   1/1  -elkkllkvllvGlpgvGKttllnrllggefai......ygptiginfgtveldg.vklqlwDtaGqerf
00526801   1/1  kkelkvvllGdsgvGKtsLlnrllg...gefiveyiptigvdfytktvev.dgkkvklqlwDtaGqerfr
00444161   1/1  -ekkdklfkillvGdsgvGKttLlnrllg...defiveyiptigvdfytktvev.dgktvklqlwDtaGq
00387321   1/1  -glkglllrlklelkkllkillvGlpgvGKTtllnrllg......defveygptiginfvtvdlkg.vkl
00513761   1/1  ---kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlpeqlgidirdlidletvmelglgpn
00520021   1/1  -lkkkllkivvvGdsgvGKttLlnrllg...gkfieeyiptigidfytktvev.dgkkvklqiwDtaGqe
00507921   1/1  sskkkkllkivlvGdsgvGKtsLlnrllg...defiveyiptigvdfltktiev.dgkkvklqlwDtaGq
00527851   1/1  -lelkvvlvGdpnvGKstLlnrllg...gkfvsdypgttgdni.lktveld.gklvklqlwDtpGqerfr
00475471   1/1  -mglkvalvGlPNVGKSTLlNaLtgak...aivanypgtTrdpnlgvvelpdgrldllaelvkpkkivpa
00526151   1/1  elkkllkvvllGdsgvGKTtllnrll...ggkfieeyiptigvdfgtvtleledlylklvlvdgknvklq
00362791   1/1  --elkilvvGdsgvGKttLlnrllg...gefiveyiptigvdfytktvev.dgkkvkltlwDtaGqerfr
00467111   1/1  -pvlvvaivGrpnvGKStLlNaLlgekvgfaivsgvpgtTrdiwmwivvlield.grpllliDTpGlgdt
00366991   1/1  -kllkillvGlpgvGKTtllnrllggef......eeyvptiginfvtveikg.vklqlwDtaGqerfrsl
00514611   1/1  lkkllkvvlvGdpgvGKttLlnrllg...gefiveyiptigvdfltktvev.dgkkvklqlwDtaGqerf
00352811   1/1  -lekkelkilllGlgnvGKsTllnrllggef.......ergpTiginvetfeidg.vkftiwDtgGqrdf
00387311   1/1  kkllkillvGdsgvGKtsLlnrllg...gefiveyiptigvdfltktvevdgkkvklqlwDtaGqerfrs
00412341   1/1  lkkkkllkillvGdsgvGKtsLlnrllg...gefiveyiptigvdfltktvev.dgkkvklqlwDtaGqe
00406821   1/1  ----------------------------------------------------------------------
00378841   1/1  -kelkillvGdsgvGKstLlnrllg...defiveyiptigvdvytktvei.dgkkvklqlwDtaGqerfr
00480422   2/2  ----------------------------------------------------------------------
00526251   1/1  kdkllkvvlvGdpgvGKstLlnrllg...gefiveyiptitvdflvktvel.dgktvklqlwDtaGqerf
00525281   1/1  -kkdkllkvvlvGdsgvGKTsLlnrllg...gefiveyiptigvdfytktvevdgkkvklqlwDtaGqer
00369571   1/1  ----------------------------------------------------------------------
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00507751   1/1  dlkllkvvlvGdpnvGKssLlnrllg...gkfvsdyppttg.dfivktveid.gklvklqlwDtaGqerf
00514601   1/1  lkkkllkivlvGdsgvGKTsLlnrllg...gefiveyiptigvdfytktvev.dgkkvklqlwDtaGqer
00356411   1/1  -kgikilllGlsgsGKSTllnrllgle.........ygpTiginegtieidg.vkltlwDtgGqesfrkl
00514591   1/1  kkllkvvllGdsgvGKTsLlnrllg...gefiveyiptigvdfytktiev.dgkkvklqiwDtaGqerfr
00515531   1/1  -kgekvallGlsgsGKSTllnrllglefa.......ygpTigptsgtiei.dgvklqlwDtgGqerfrsl
00527351   1/1  kdkllkivlvGdsgvGKttllnrllg...gefiveyiptigvdfltktiel.dgkkvklqlwDtaGqerf
00481131   1/1  -lelkvvlvGdpnvGKssLlnrllggk....fvsdypgttrdfivktveld.gklvklqlwDtaGqerfr
00455591   1/1  -kkdkllkilvvGdsgvGKttllnrllg...gefiveyiptigidfytktvev.dgkkvklqlwDtaGqe
00497591   1/1  lkglkvvlvGrsgvGKStLlnallgekvakvsdisatlgrgpgttrdiilikldrg..llliDtPGiref
00410531   1/1  -gelknlslelkkglkillvGlngvGKTtllkrlag......gefvdygptigvnfktvevdg.vklviw
00520531   1/1  ----------------------------------------------------------------------
00525011   1/1  -kelkvvlvGdpgvGKssLlnrllgge...fvedylpttgddf.tktvevd.gktvklqiwDtaGqerfr
00414121   1/1  kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgqlledlgvlavrlgigyvpqtlgl
00482521   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00520051   1/1  psrkelklvvvGdsgvGKTsLlnrllg...gkf.ekyvptvgvdyl.ktvevd.gklvrlqlwDtpGqer
00494041   1/1  kkeikilllGlgnvGKttllnrllggef......depgpTigvnvttftl.kgvklqlwDtgGqerfrsl
00372471   1/1  ----------------------------------------------------------------------
00515511   1/1  -kgekvlllGlsgsGKSTllnrllglefl.......pgpTigptegtieidg.vklqlwDtgGqerfrsl
00490731   1/1  -dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaeelgldvll
00527641   1/1  -----lkkkkllkivllGdsgvGKTsllnrllg...gefveeyiptigvdfytktiev.dgknvklqlwD
00387941   1/1  -mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgpslslllglegeplgladllageadle
00495821   1/1  akelkvlllGlsnvGKttllnrl........kfvety.pTigvnfktveidg.vklqiwDtaGqerfrsl
00360951   1/1  ---------------------------------------------------------liDtppglgdlgl
00495771   1/1  -------------------------------------------------------------------nel
00480421   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           MLAGVGGIDLVLLVIAADEGVMPQTKEHVDIIQLLQVKKGIVVLTKIDMVDEEWLSLVTEEIREYLKDTV
00374071   1/1  itidiaavsfet.dgrkitliDtPGhvdfikevirglsvadgallvvdavegefeaglsvepqtrevlll
00492921   1/1  llslellkqlnliDtPGhedfssevlralrvadgallVvdatdgvslpqteevlelllelgvpniivvlN
00431331   1/1  slllalvldsldeErergiTidiaavsfet.dgrkitliDtPGhedfikevirglsvadgallVvdaseg
00362391   1/1  liDtPGhvdfvkevlrglrvadgailVvdavegvmpqtrehlllarllgvpkiivviNKiDlvdaderle
00396721   1/1  iaavsfetk.grkltliDtPGhedfrkevirglrvadgailVvdasdgesfagievepqtrellllarll
00372481   1/1  td.grkinliDtPGhedfskevlrglavadgallVvdaadgvspqteevlllarllgvpkiivvlNKiDl
00504231   1/1  edfsslvlralrvadgallvvdatdgvtpqtlevlllllllgvp.iivvlNKiDlvdadrleevleelee
00369581   1/1  itliDtPGhedflkevlrglavadgallVvdategvlpqtrevlllakllgvpniivvlNKiDlvdaeer
00401211   1/1  lgvleldgpkllllDtPGhedflkellralaladgallvvdadegeflpqtlevlllllelgvkpiilvl
00516481   1/1  rergitidsaavsfetd.grkinliDtPGhedfvkevlrglrvadgallVvdategvepqtrevlllarl
00517691   1/1  rgitidvalarllldg.rkilllDtPGhedfvkevlralrladgallvvdadegvslpqtrevlllllll
00504221   1/1  ----------------------------------------------------------------------
00469361   1/1  g...lnliDtPGhedfrsltlrylrgadgallVvdatdgvsfqtlellelllelgvp.iilvlNKiDlvd
00411701   1/1  ssatslewelieelllelkldidgkgylinliDTPGhvdFsseveralrvaDgailVvDavegvepqtee
00494851   1/1  ..gvkltliDtpGlgdldviielaerlrdlvreylralrgadgvllvvdatdglfeqdlellklllelgv
00471271   1/1  rdikvvtvegk.gvkltliDtpGlgdpaslqeefralvlrylrlrgadavllVvdatdpglfeqdlellk
00484261   1/1  rslverylrgfleeadgvllVvdatedregfeeqtkellellrllglllllgvp.iilvlNKiDlldare
00504821   1/1  selqedfrkltlrylrgadvvllvvdatdglfeqtlellellrellpgvp.iilvlNKiDlld..drevl
00523461   1/1  egalldllerflrslllsylrgadvvllvvdatdlesfesvllllglkeqllellkllellgvp.iilvl
00514481   1/1  pGqedfrrltlrylrgadgvllvvdatdresfegveeqleellelllllgvp.iilvlnKiDlldarele
00488191   1/1  liDtPGlgdllviielaslledfrsltlrylrgadvvllvvdatdglleqtlelleellelgvp.iilvl
00465511   1/1  apellqedfralvlrylrgadgvllvvdatd.lleqllelleellelgvp.iilvlNKiDlldar..evs
00519271   1/1  Gqedfraltlrylrgadgvllvvdatdresfegveeqleellelllllgip.iilvlNKiDlldaldlre
00492901   1/1  ----------------------------------------------------------------------
00517931   1/1  lrllylrgadgvllvvdatdrdsfeglkeqllellelllllgvp.iilvlNKiDlldalelrevleelae
00528591   1/1  tpGqedfrslrlrylrgadgvllVvdatdresfegvekqleellellrllgvp.iilvlNKiDllearev
00515101   1/1  DtpGqedfrrltlrylrgadgvllvvdatdresfegveeqleellellrllgvp.iilvlNKiDlldaee
00526911   1/1  fraellrsylrgadgillVvdatdpesgfeeltkellellrelgllagvpliilvlNKiDlldareveel
00504491   1/1  inliDTPGhvdFseeveralrvlDgavlvvdaveGvepqtetllrlarkygvp.iivfiNKmDrpg..df
00515821   1/1  vDtpGqedfrslvlrylrgadgvllVvdatdresfegveeqleellellkllgvp.iilvlNKiDlldae
00481801   1/1  glqedfrslllrylrgadvvllvvdatdglleqdlellellrelgvp.iilvlNKiDlld.....vllee
00409841   1/1  idfaseptnlldleiieallraleeadvvllvvdadrglleqdlellelllelg.kpvilvlNKiDllda
00498681   1/1  lqedfrslllrylrgadvillvvdatd.lsfedleklleelrellpellgvp.iilvlNKiDlldaeel.
00504201   1/1  ----------------------------------------------------------------------
00511561   1/1  lqerflslrvlrylrgadvvllvvdatdglfeqleellellr...gvpiilvlnKiDlldarellell..
00414001   1/1  kpkklvgapvvlvDtpGliegaslgeglgrqflaaleeadvilhVvdasdplgiilvvnkvdpledieii
00401191   1/1  ----------------------------------------------------------------------
00520541   1/1  kgylinliDTPGhvdFseeveralrvlDgAvlvvdaveGvevqTetllrqalkygip.iivfiNKlDrlg
00374121   1/1  DtpGqeefrsltlrylrgadgvllVvdasdgdsfeevlelleellellllanvp.iilvlNKiDlldare
00362371   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00527241   1/1  frslrllylrgadgvllVvdatdpesfeglkkwllellellelagvp.iilvgnKiDlle..erevslee
00405881   1/1  geglvrqalealeradvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDeptnel.
00517671   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00462541   1/1  ----------------------------------------------------------------------
00531961   1/1  slrllylrgadvvllVvdatdgesfedlleelleelrellpgvpiilvgNKiDlldarellellellelg
00507411   1/1  pkkivpakivlvDtpGlikgaslgeglgnqflaaireadvillVvDasegltliihvegsvdPvedieii
00402391   1/1  tllylrgadgvllVvdasdgdsfeellkwleellelllllg.ipiilvlNKiDlldalslrevleelale
00463921   1/1  lrllylrgadvvllvvdatdresfeeldeellellrelgpgvp.iilvgnKiDlldarellellellgll
00407471   1/1  wlrylegadavilvvdasdpdsfeelkelleellellllagv.piilvlNKiDlldakllaellellrlv
00447401   1/1  sllelylrgadgvllVvdatdpesfenlkkwleellellgllllagvp.iilvgnKiDlldrevleelae
00517841   1/1  espellaeflidggekltdldelrkeieeatdall.gpgkgfsfdtieleielpdlpnltlvDtPGlgsa
00511041   1/1  rslrllylrgadgvllvvdatdpesfeglkkwllellellelagvp.iilvgnKiDlled..revsleel
00378621   1/1  tlrylenadvvllvvdasdpdsfeellelleellellllag.vpiilvlNKiDlldaallrevleelale
00424711   1/1  glgnvafksalgglglealldlllellkellellrlslllkkglkvalvGlpnvGKSTLlnaLlgak..v
00399991   1/1  slrerylrgadgvllVvdatdresfeglkkwleeilellllagvp.iilvgNKiDllee..revsleeal
00529141   1/1  rslrllylrgadvvllvvdatdgesfenlkkwllellellelagip.iilvgnKiDllea..revsleel
00357861   1/1  frslrslyyrgadgvllvyditdgesfeelkkwleellrlapnvpiilvgnKiDlldarev....eeale
00518311   1/1  .ltllylrgadvvllvvdatdresfeglkkwllellellelagvpi.ilvgnKiDlld..erevsleell
00361531   1/1  lrerylrgadgvllVvdatdgesfeelkewleeilellplad.vpiilvgNKiDlle...revleeeaee
00370451   1/1  slrelylrgadgvllvvdatdresfedlkkwleeilellpagvpiilvgnKiDlldalslrevseeeale
00528321   1/1  qerf..ltllylrgadvvllvvdatdgesfedlkkwleellellelagvpi.ilvgNKiDlled..revs
00514581   1/1  dslrelylrgadvvllvvdatdgesfedlkkwleellellklagvp.iilvgnKiDllea..revsleel
00477011   1/1  setpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdltlv
00515621   1/1  welyyrgadgvilVvdatdrdsfeevkkwleellelallag.vpillvgNKiDlldalslrevseeeale
00518321   1/1  qerfrslrllylrgadvvllVvdatdresfeevdeellellrelglgvp.iilvgnKiDlldarellell
00492691   1/1  frslrklyyrgaleailllllglllleleeadvvllVvdatdresfeeldlellellrellpgvpiilvg
00514721   1/1  frslrllylrgadvvllVvdatdgesfeeldewllellrelgpgvp.iilvgnKiDlldarellellell
00517041   1/1  rsllelylrgadvvllvvdatdgesfedlekwleellelleagvpiilvgNKiDlldarevs..leeale
00514501   1/1  llelylrgadvvllvvdatdgesfedlkkwleellellgagvpiilvgnKiDllear..evsleellela
00528411   1/1  rfrslrllylrgadvvllVvdatdgesfedlkkwleellelleagvpi.ilvgnKiDlldarevsl..ee
00525021   1/1  frslrllylrgadgvllVvdatdgesfedlkkwleellellelagvpi.ilvgnKiDlle..erevslee
00528791   1/1  frslrllylrgadvvllVvdatdresfedlkewleelleladllagvp.iilvgnKiDlld...revlle
00449901   1/1  slrelyyrgadavllvvdatdpesfenlkkwleellelldllllagvp.iilvgnKiDllerevlleele
00480411   1/1  ----------------------------------------------------------------------
00432181   1/1  gekqrvalalallreadvlllvvdadeptsfldle...llellrelllagkpvilvlnKiDlldar....
00481541   1/1  frslrllylrgadvvllvvdatdgesfeeldeellellrellagvp.iilvgnKiDlldarellellell
00514711   1/1  sltelyyrgadgvllVvdvtdresfenlkkwleellelaedvpiilvgNKiDlldar..evseeealela
00520981   1/1  slrllylrgadvvllvvdatdresfeevdewllellrelglnvpiilvgnKiDlldarellellellgll
00470231   1/1  ldg.vklqlwDtaGqerfrsltlrylrgadavllVvDasdydlvllepdsferleewleelrellanpll
00514621   1/1  rslrelyyrgadgvilVydvtdresfedlkkwleellelle.pgvpiilvgnKiDllda..revseeeal
00403151   1/1  slrelyyrgadgvllvydvtdresfenvlswleelrellgllllegvp.illvgnKlDlptne.rdvsle
00358141   1/1  slrelylrgadgvllVvdvtdgesfeelkkwleeilnllpladvp.iilvgnKiDllee..revseeegl
00410321   1/1  lllylrgadgvllVvdatdgdsfeevkellleilelaglagvp.iilvgNKiDllealgarevseelale
00362311   1/1  ----------------------------------------------------------------------
00519521   1/1  wllyfedadaiifvvDasdydqvlledelrnrleellelleeilnllllagkp.illvlNKiDlldekll
00442331   1/1  frslvelylrgadgvllVvdatdresfegvkkwleeilrllplanvp.iilvgnKiDllear..evseee
00444821   1/1  rslwllylrgadavllVvdatdgdsfeelkellleilellllagvpi.ilvgNKiDllealslrevseel
00526801   1/1  slrelyyrgadgvilVydvtdresfenlkkwleellelap..anvpiilvgnKiDllea..revseeeal
00444161   1/1  erfrslrelyyrgadgvllVydvtdresfenlkkwleeilrllp..sgvpiilvgNKiDllder..evsk
00387321   1/1  qlwDtaGqerfrslwllyyrgadgillVvdatdgdsfeevaklleeilelag.lenvpiilvgNKiDlld
00513761   1/1  galvfaleellttldillealell.eedydyiliDtpGglelrallalllaiaralaadeillvddptsg
00520021   1/1  rfrslrelyyrgadgvilvydvtdresfenlkkwleeilellesnvpiilvgnKiDlpear..evseeea
00507921   1/1  erfrslrelylrgadgvllVydvtdresfedlkkwleellellelpd.vpiilvgnKiDlld...revse
00527851   1/1  slrllylrgadvvllvvdatdresfeeldewllellrelgpgvp.iilvgnKiDlldalsllellsllgl
00475471   1/1  pivlvDtpGliegasegeglgnqflaaireadvilhvvdasegltivhveglvdplrdieiillelilad
00526151   1/1  lwDtaGqerfrslrplyyrgadgvilVydvtdresfenlkkwleellelae.lpnvpivlvgNKiDlpda
00362791   1/1  slrelyyrgadgvllvydvtdresfedlkkwleellklle..sgvpiilvgnKiDllda..revseeeal
00467111   1/1  ekedekelvkiallallladvvllvvd..ggiteqdlellklllelg.kplilvlnKwDllekeeleell
00366991   1/1  wllylrgadgillVvdatdgdsfeevakwleellnlag.ladvpillvgnKiDllealsarevseeeale
00514611   1/1  rslrelyyrgadgvllvvdvtdresfedlkkwleellelle..pnvpiilvgnKiDlpear..evseeea
00352811   1/1  rklwilyfegadaiifVvdssdydsflnvdkwtnrleealellesillnrllknvpiilvlNKiDlleek
00387311   1/1  lrelyyrgadgvllvydvtdresfedlkkwleeilrlldpgvpiilvgnKiDllee..revseeealela
00412341   1/1  rfrslrelyyrgadgiilvydvtdresfenlkkwleeilrlld..pgvpiilvgnKiDlleer..evsee
00406821   1/1  ----------------------------------------------------------------------
00378841   1/1  sllelyyrgadgillvvdvtdresfeelkkwleeilrlle..agvpiilvgnKiDllg...rqvlveear
00480422   2/2  ----------------------------------------------------------------------
00526251   1/1  rslrelylrgadgvllvvdvtdpesfedlkkwleellelld..snvpiilvgnKiDllear..evseeea
00525281   1/1  frslrelyyrgadgvllVvdvtdresfenlkkwleellelle.anvpiilvgnKiDllear..evseeea
00369571   1/1  ----------------------------------------------------------------------
00440861   1/1  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00507751   1/1  rslrllylrgadvvllvvdvtdresfedlkkwleeilellelagvpi.ilvgnKiDllea..revsleea
00514601   1/1  frslrelyyrgadgvllvydvtdresfenlkkwleellelapsnvpiilvgnKiDlpea..revseeeal
00356411   1/1  wilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenv.piilvlNKiDlleekiv
00514591   1/1  slrelyyrgadgvilVydvtdresfenlkkwleellelapsnvpiilvgnKiDlldar..evseeealel
00515531   1/1  wilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpillvlnKiDlleakera
00527351   1/1  rslrelyyrgadgiilVydvtdresfenlkkwleellellp..snvpiilvgnKiDlpea..revseeea
00481131   1/1  sllelylrgadvvllVvdatdresfeeldeelleelrelaagvp.iilvgnKiDlldalsllllllllgl
00455591   1/1  rfrslrelyyrgadgillvydvtdresfeelkkwleeilrlle..snvpiilvgnKiDllder..evske
00497591   1/1  glldeeaveltllylegadllllvvdathg.fepdcavlealee.ggipiilv-----------------
00410531   1/1  DtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpi.ilvgnKlDlldall
00520531   1/1  ----------------------------------------------------------------------
00525011   1/1  sltelyyrgadgvllvydvtdresfedlkkwleellelldllsnvpiilvgnKiDlld..erevseeeal
00414121   1/1  fpaltvlellalalllredpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldl
00482521   1/1  ----------------------------------------------------------------lpatae
00504481   1/1  ----------------------------------------------------------------------
00520051   1/1  fr.....yyrgadgvllvfdlsdpesfenlkkwlkellellglllpgipillvgtK.Dlledldlrevsl
00494041   1/1  welyfegadaiifvvdlsdgdsflnldkwlnrleeslellesilnllllanvpillvgNKiDlleaklle
00372471   1/1  ----------------------------------------------------------------------
00515511   1/1  wllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpillvlnKiDlleaklvl
00490731   1/1  garggdlsgglrqrlarallgdydvliiDtpgtldvllelallellkella.elgadvvllvvdatlgle
00527641   1/1  taGqerfrslrplyyrgadgiilVydvtdresfenlkkwleellelld.pnvpivlvgnKiDlpda..re
00387941   1/1  dailetpegldllpaglllaglellrgerlrelleel..addyDvviiDtppglgdl..tllalaaadgv
00495821   1/1  wllyyrgadaiifVvDlsdrdqvlledelvnsfeevlewleellnnallanvpillvgNKiDl.......
00360951   1/1  ltlaallaadgvliVttpealslqdalrllelleklkdnpglpvlgvvlNkvdlrte...ggvleelaee
00495771   1/1  lrpivanvdlvlivvdardplfslnlllrylvlaeaagippvlvlnKiDlleeeedlelleellkelesi
00480421   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LSEAPVVPVSSTTKQGIPQLLDLIDQFVDDTEERNSSGKLRLPIDRVFSVTGFGTVVTGTLLSGRVSTGD
00374071   1/1  alllgvphiivviNKiDlvdadeerlleileellellkklgylpigvpvvpvsal---------------
00492921   1/1  KiDlvdadrleevleeleellkelgfldvpiv--------------------------------------
00431331   1/1  vlerllelepqtrevlllalllgvphiivviNKi------------------------------------
00362391   1/1  lvveellellkklglllelvpvvpvSaltgegvdelldall-----------------------------
00396721   1/1  gvphiivviNKiDlldadeleevleeieeelgellaklgfplgdv-------------------------
00372481   1/1  ldadelleevkeelrellkllgllledvpvvpiSaltgegvdelldall---------------------
00504231   1/1  llkllllpldvpivpisaltgegvdelleailel------------------------------------
00369581   1/1  leevleelrellkllgllgelvpvvpiSaltgegvdellda-----------------------------
00401211   1/1  NKiDlvdaelleevleeleellkllgllnv----------------------------------------
00516481   1/1  lgvpriivvvNKiDlvgadeerleevleeieellkllglvpldvpi------------------------
00517691   1/1  gvpniivvlNKiDlvdaeeleevleelrellk--------------------------------------
00504221   1/1  ----------------------------------------------------------------------
00469361   1/1  adeleeleellkklglplelvpllldllldsllldllllgllsslll-----------------------
00411701   1/1  vlrqarkegip.iilviNKiDrlgadl.llvleelyeklsrlieevnviisglnddllgkllvsplqgpv
00494851   1/1  .piilvlNKiDlldeaelevlleelrellke..l------------------------------------
00471271   1/1  ellelfgelagvp.iilvlNKiDlldaeev.eleeeiaellalll-------------------------
00484261   1/1  veevleelkeelkalakelglpiglesn------------------------------------------
00504821   1/1  leelrel.....lglvpvvevsaktgegvdelfeall---------------------------------
00523461   1/1  nKiDlladaeeveellaellellgllg..di---------------------------------------
00514481   1/1  evleelaellall..lgipvvevsak--------------------------------------------
00488191   1/1  NKiDlldaeeleevveeleelllalg.lgip---------------------------------------
00465511   1/1  leeleelakklgl..vpvvevsaktgegvdelleall---------------------------------
00519271   1/1  vleelaellak..elgipvvetSaktgegvdel-------------------------------------
00492901   1/1  ---------------------------------rdldkpfrlpvervfdingpgtelddlrGtVvtGtvl
00517931   1/1  alake..lgipvietSaktgegvdelfeall---------------------------------------
00528591   1/1  eellaelellllllllgllllelaeelgi-----------------------------------------
00515101   1/1  lrevseelaellakl..lgipvvetsakt-----------------------------------------
00526911   1/1  leelreelkklakelglllellllllell-----------------------------------------
00504491   1/1  lelleeirellglllplqlpigsgsdfvgv----------------------------------------
00515821   1/1  elrevleelaellakel..gipvvetSaktg---------------------------------------
00481801   1/1  leellke..lglppvvpvsaktgegvdelleallel----------------------------------
00409841   1/1  eellleevleellkllaelg..gvpvvpiSalt-------------------------------------
00498681   1/1  ...eelkellkl...lgipvvevsaktgegvdelleallel-----------------------------
00504201   1/1  ---------------------------------rdldkplrlpvqdvfkisgvgtvvtgrvesGvikvgd
00511561   1/1  ......lalllglpvvevsaktgegv--------------------------------------------
00414001   1/1  saelgladlellekllealirrpnsgkssllnkllgeerlilskilgtlrdv------------------
00401191   1/1  -------------------------------PerdldkplrlpvqdvfdingpgtdlddlrGvVvtgrve
00520541   1/1  adllelle.eieerlgllvvplqlpigfgs----------------------------------------
00374121   1/1  leellellellllllvsteealelaeel------------------------------------------
00362371   1/1  --------------------------------krdldkplrllvldvflisgrGtvvtgrvesGvlkvgd
00491101   1/1  ------------------------------pPerdldkplrlpvqdvf..kgvgtvvtGrvesGvvkvgd
00374051   1/1  ------------------------------------dkplrllvqdvfkisgvgtvvtgrvesGvvkvgd
00516461   1/1  ---------------------------------rdldkplrlpvqdvfrisgvgtvvtgrvesGvlkvgd
00396701   1/1  ----------------------------------dldkplralvidvfldsgvgtvatgrvesGtlkvgd
00379751   1/1  -----------------------------------vvfPlrlpildvfvingvgtvvvGvrVlsGvlkvg
00527241   1/1  llelakel...glpvvetSaktgegvdelfeala------------------------------------
00405881   1/1  ...dlellellee...lggtvvlvSahdgegldelldailel----------------------------
00517671   1/1  ---------------------------------rdldkpllllversFdingpGtelddlkGgVvgGsil
00465381   1/1  ----------------------------------dldkplrllvqdvfkisgvGtvvtgrvesGvikvgd
00450341   1/1  ------------------------------lPerdedkpfrlpvqdvfkisg.gtvaggrvesGvikvgd
00372461   1/1  -------------------------------PerdldkplrllvqdvfkdsgvgtvatgrvesGtlkvgd
00462541   1/1  ----------------------------------------------------------------------
00531961   1/1  lvsleellelake..lgavpvvetSaktgegvdelfealaell---------------------------
00507411   1/1  etELiladlellekrleklekkaklggkkllltl------------------------------------
00402391   1/1  l..akllgipvfetSaktgegvdelfdalle---------------------------------------
00463921   1/1  lvsleellelake..lgavpvvetSaktgegvd-------------------------------------
00407471   1/1  lleellllalllgipvvetSAktgegvd------------------------------------------
00447401   1/1  alakel.....ggipvvetSaktgegvd------------------------------------------
00517841   1/1  avgdqpeeleeafraltleylreadtli------------------------------------------
00511041   1/1  lelakel...gipvvetSaktgegvdelfe----------------------------------------
00378621   1/1  lakllg..ipvvetSAktgegvdelfea------------------------------------------
00424711   1/1  aivsdipgtTrdivlgvl....gkkl--------------------------------------------
00399991   1/1  elaeelgl...pvvetSaktgegvdelf------------------------------------------
00529141   1/1  lelakel...glpvievSaktgegvdelfealael-----------------------------------
00357861   1/1  lakelgl...pffetSAktgegveelfe------------------------------------------
00518311   1/1  elakel...glpvietSaktgegnvdelfeala-------------------------------------
00361531   1/1  lakelgl...pvvetSaktgegvdelfeall---------------------------------------
00370451   1/1  lakelgl..pfietSaktgegvdelfealve---------------------------------------
00528321   1/1  leellelakel...gipvietSaktgegvdelfea-----------------------------------
00514581   1/1  lelakel...glpvietSakdsetg---------------------------------------------
00477011   1/1  DtPGlgsvavvdqlsggqkqrvalar--------------------------------------------
00515621   1/1  lakelg..ipvfetSAktgegvdelfea------------------------------------------
00518321   1/1  ellglllvsleealelak..elgavpvvetSaktgeg---------------------------------
00492691   1/1  NKiDlldarellelllllglllvsleeilela--------------------------------------
00514721   1/1  glglvsleealelake..lglvpvvetSakt---------------------------------------
00517041   1/1  lakel...glpvietSaktgegvdelfealaelllel---------------------------------
00514501   1/1  kelgl...pvvetSaktgegvdelfealael---------------------------------------
00528411   1/1  llelakel...glpvietSaktgegvdelf----------------------------------------
00525021   1/1  llelakel...glpvvetSaktgegvdelfeal-------------------------------------
00528791   1/1  eleelakel...glpvvetSaktgegvdelfeala.....k-----------------------------
00449901   1/1  elakelg.....lvpfvetSaktgegvdelf---------------------------------------
00480411   1/1  ----------------------------------------------------------------------
00432181   1/1  ........eelakllgvpvvevSaktgegvdel-------------------------------------
00481541   1/1  glllvsleealelake..lgavpvvetSaktge-------------------------------------
00514711   1/1  kelgl...pvfetSaktgegvdelfealae----------------------------------------
00520981   1/1  lvsleealelake..lgavpvvetSaktg-----------------------------------------
00470231   1/1  anvpiilvgNKiDl............leelakelgla..p------------------------------
00514621   1/1  elakelgl...pfietSaktgegvdelfea----------------------------------------
00403151   1/1  ealelalelgl..lpvievSaktgegvdelfel-------------------------------------
00358141   1/1  elakelg..lipfvetSaktgegvdelfea----------------------------------------
00410321   1/1  lakelg..ipvvetSAktgegvdelfdalvel--------------------------------------
00362311   1/1  ---------------------------------reeevlglaevedvfsisgvgtvaggrvesGvlkrgd
00519521   1/1  aelledlfpeykglnndleaaleyilskflglnl------------------------------------
00442331   1/1  alelakelgl...pvvetSaktgegvdelfeallkl----------------------------------
00444821   1/1  alel..akllgipvfetSAktgegvdelfeal--------------------------------------
00526801   1/1  elakel...glpfietSaktgegvdelf------------------------------------------
00444161   1/1  eearelak...elglpfvetSAktgegv------------------------------------------
00387321   1/1  alllrevleelglelakelg..ipffetSAkt--------------------------------------
00513761   1/1  ldaetqleilelllelllklgip.iilvlnK---------------------------------------
00520021   1/1  lelakel...glpfietSAktgegveelfealvrll----------------------------------
00507921   1/1  eealelakelgl...pfietSaktgegvdelfealve---------------------------------
00527851   1/1  revlleealelak..elglvpvvetSaktgegvdelfe--------------------------------
00475471   1/1  lellekrleklgklakggvkdllealelll----------------------------------------
00526151   1/1  revse..eeaeelakel...glpffetSAktgegvee---------------------------------
00362791   1/1  elakelgl...pfletSAktgegvdelf------------------------------------------
00467111   1/1  kelkplllflvrdfapvlfisaltgtgldellealeellgahpeplvkgkilkliya-------------
00366991   1/1  lakelg..ipfvetSAktgegvdelfea------------------------------------------
00514611   1/1  lelakelgl...pfietSaktgegvdel------------------------------------------
00352811   1/1  sveeilelleyfpdylgllklldlllllldpnlveda---------------------------------
00387311   1/1  kelgl...pfvetSaktgegvdelfeal------------------------------------------
00412341   1/1  ealelakelgl...pfvetSAktgegvd------------------------------------------
00406821   1/1  ----------------------------------------------------------------------
00378841   1/1  alakel...giplfetSaktgegvdelfealv--------------------------------------
00480422   2/2  ----------------------------------------------------------------------
00526251   1/1  lelakelgl...pfietSaktgegvdelfealaellle--------------------------------
00525281   1/1  lelakelgl...pffetSaktgegvdelfeala-------------------------------------
00369571   1/1  ----------------------------------------------------------------------
00440861   1/1  lvid.d.glteldlellkllkelg.kpvilvlnkiDllkke-----------------------------
00507751   1/1  lelakel...glpfietSaktlgegvdelfea--------------------------------------
00514601   1/1  elakelgl...pffetSaktgegvdelfeal---------------------------------------
00356411   1/1  eellellgleykgdrdpeelsggqkqrvalaral------------------------------------
00514591   1/1  akelgl...pffetSaktgegveelfealak---------------------------------------
00515531   1/1  ...eellellgl..gdlldklpselsgGqk----------------------------------------
00527351   1/1  lelakel...glpfietSaktgegvdelfeal--------------------------------------
00481131   1/1  revlleealelake..lglvpvietSaktge---------------------------------------
00455591   1/1  ealelake...lglpfletSaktgegvdelf---------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00410531   1/1  lrevsaelalelakelg..ikfietSAktg----------------------------------------
00520531   1/1  ------------tglGveeLldaivdllpsP.kadpdgplqalvfkivydpyvgriafvrvysGtlkkgd
00525011   1/1  elakelgl...pfietSAktgegvdelfealaell-----------------------------------
00414121   1/1  .lkelaeqlgl.tvlivlnKiDlls..elthdle------------------------------------
00482521   1/1  qlrvpvlygsaldgkgvqpllda...........dpdgplvalvsklvadpdvgrflafgRvysGtlkkG
00504481   1/1  ------------------------------pPkgdpdkpllalvfkvfydpyrGrvalvrvysGtlkkgd
00520051   1/1  eealelakel..ggvpyfetsaktgegvdelfdelarl--------------------------------
00494041   1/1  ellkllfpeydglndledalkfievsfelllkla------------------------------------
00372471   1/1  ----------------------------------------------------------------------
00515511   1/1  lllvglfdlldglpselsggqkqrvalaral---------------------------------------
00490731   1/1  aadr.ilvlleglgvp..gvvlNkldlvaeg....-----------------------------------
00527641   1/1  vseeealelakelgl...pffetSaktgegveel------------------------------------
00387941   1/1  llVvdpellalraarrllellrkl----------------------------------------------
00495821   1/1  .....leelakkl...glkvfetsaktgegveel------------------------------------
00360951   1/1  lglpvlgvipldeavreaallgepvvelepsskaaeayrelaeelleli---------------------
00495771   1/1  ...gvdvvlvsakkgalldilldilkgk------------------------------------------
00480421   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TVEIMPLGTVSRVRSIQVHGKKVEQARAGQRTAVNIIGVEVEEVKRGSVLVTPNSVEPSHRMDVKFLLLE
00374071   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00504221   1/1  ------------------------------------------------------slevtdlidvklklle
00469361   1/1  ----------------------------------------------------------------------
00411701   1/1  vfgsaltgv-------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00492901   1/1  sGvlkvGdeveilplllvkeegklkleglttkvksleafgkeleeavagdlvglglel------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00504201   1/1  evrvlpsglttkvksievfkedvdeavagdnvglllkgvdvedisrGdvlvdpgn---------------
00511561   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00401191   1/1  sGvlkvGdeveilpllllkeggkllllglttkvksievfrkeleealagdlvglllkld-----------
00520541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00362371   1/1  kvvllpsgviltgkvksiemfkkdvdealagdivglllkgigledvrrGdvltvpgnp------------
00491101   1/1  evlvlpsgkttkvksiemldkveldeavaGdnvgllllgie.edisrGdvlvdpgnp-------------
00374051   1/1  kvlvlpsgktvevksievfreevdealaGdivglllkgvdlkdirrGdvltdpgnppplp----------
00516461   1/1  evlvlpsgktvrvksievfdeeveeavagdivgltlkgv..edisrGdvlvdpdnpp-------------
00396701   1/1  kvvvlpsgktgrvksllvfkedvdealaGdivgillkgvglkdikvGdtltapenpppl-----------
00379751   1/1  dpvlvlpggkvgevkslernkedvkearaGdevaialkgvtvgrdikrgdvlyvlesres......advl
00527241   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517671   1/1  qGvlkvgdeieilPgilvkeggkllllpiltkvksleafdkeleeavpGglvgl----------------
00465381   1/1  kvlilpsgkvlkvkvksievfrkevdeavaGdivglllkgvdledirrGdvltd----------------
00450341   1/1  kvrvlpsg..gkvkslerfkedveeAvaGdevglllegii.edikrGdvllapgs---------------
00372461   1/1  kvrvlgtlpsvlvgevksllrfredvdeavaGdivglllkgvglkdikrGdvltdpen------------
00462541   1/1  ----------------------------------------------------------hdkfeaelyils
00531961   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00480411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00362311   1/1  lvrllrdgvvvlegevkslkrfkedvkevlaGdecGlllkgfn..dikegdvieayelvev---------
00519521   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00406821   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00480422   2/2  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00369571   1/1  ------------------------------------------------------pikavtkfeAevyvLn
00440861   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00520531   1/1  kvlllrtgkkekvgrllvflglkreevdealaGdivavv....glkdikvgdtltdaenpvalp------
00525011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00482521   1/1  dkvrvlgpgyspgdeedlkkvrvgrlllfmgrereevdeapaGdivai..vgld.daiikgd--------
00504481   1/1  kvllv..gkkvrvgellvflglereevdealaGdivaiv....glkdirvGdtltdpenplalel-----
00520051   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00372471   1/1  ----------------------------------------------------------vtkFeAqvyvLn
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00480421   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SAEKPLKNRARVRLYLGTDEILGRVRLLDREEIEPNQEAYVQLELEERGIAGKGDRFVIRSYSPMRTIGG
00374071   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00504221   1/1  lleknlknkdrvrlyvGtlevlarvvlldkvklndkeenlileelepGeeayvqlrleekvvaekgDrfv
00469361   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00379751   1/1  ilvlredltlgdlpllhillkllaied-------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517671   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00462541   1/1  keegGrktpltngyrpqlhlgtadvtarivllldpemvmpGdnalvqlvllkpvalepgdrFalRegg..
00531961   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00480411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00362311   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00406821   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00480422   2/2  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00369571   1/1  heegGrptpilagyrpvlhlgtadvtariallegpefvkpGdaalvvlelikpialepggrfalRegg..
00440861   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00372471   1/1  heegGrptpilagyrpvlhvgtadvtarivllegpefvkpgdaaivvlelikpivvepggrfalReggr.
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00480421   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GVVIEPNAPKHKRYRSEVLEGLATKEKGTPEELVNQLLAGKQGLFSPEEIIEATGLAGDDLKISIEKLQS
00374071   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00504221   1/1  irrldlpptplrti--------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517671   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00462541   1/1  rtvGgGvvldilppklkr----------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00480411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00362311   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00406821   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00480422   2/2  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00369571   1/1  rTvavGvv--------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00372471   1/1  .TvavGvv--------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00480421   1/2  ---------------------lsedqeklleklldllaegglePPtvkeladklgldekevrellrlllr


                         -         -         +         -         -         -         -:490
query           EQQVKCIPVDKKSLYIAQFTYNKWRQEIKSMVINYHREYPLREGYPKEELRSRKFPFINNKHFQYLLQAM
00374071   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00504221   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517671   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00462541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00480411   1/1  ------------------evleallqkllalLaeyheenPlrpGigkeeLrsrllprldeklfdalleal
00432181   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00362311   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00406821   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00480422   2/2  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00369571   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00372471   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00480421   1/2  egll------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EIDGLLKLHDKTLALAEFTGELSGSQQKLVQDMICAIQEGNFQPPSWVEVVKKFRLKDAESQEYLQYFLR
00374071   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00504221   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517671   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00462541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00480411   1/1  leegllvlegdlvrlpgfkvk-------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00362311   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00406821   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00480422   2/2  ---------------------lsedqeklleklldllaegglePPtvkeladklgldekevrellrlllr
00526251   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00369571   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00372471   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00480421   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TGQLVKLSDDELYYTADRYQQAKTKIVEYLKENKEISVAQTRDLLKTSRKFTLPLLETMDRERLTRRVGD
00374071   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00504221   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517671   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00462541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00480411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00362311   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00406821   1/1  -----------------ealeelrkllallaengslsvaelrdllglsRkyvialleyldregltrrvgd
00378841   1/1  ----------------------------------------------------------------------
00480422   2/2  egllvkvsedlffha-------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00369571   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00372471   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00480421   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           NRVLV-----------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00504221   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00492901   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00517671   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00462541   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00480411   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00362311   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00406821   1/1  krvLrdd---------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00480422   2/2  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00369571   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00372471   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00480421   1/2  ----------------------------------------------------------------------