[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50753.1


[Show Plain Result]

## Summary of Sequence Search
   1::394
  38::389  1.4e-94 40.0% 0048996 00489961 1/1   lasmic binding protein-like I           
  37::391  7.1e-93 39.1% 0049989 00499891 1/1   lasmic binding protein-like I           
  37::391  3.6e-87 36.7% 0045352 00453521 1/1   lasmic binding protein-like I           
  30::392  2.2e-78 31.6% 0046641 00466411 1/1   lasmic binding protein-like I           
  32::387  3.8e-64 28.6% 0039493 00394931 1/1   lasmic binding protein-like I           
  37::392  4.6e-55 29.8% 0036537 00365371 1/1   lasmic binding protein-like I           
   1::394


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKHFRLAALLVALVMLAGLVSGCGGGGEEKKAADANEIVIGGNLELSGPVATFGTAMKNGAEMYFEEVN
00489961   1/1  -------------------------------------pikiGvllplsGpaaalgkalragaelaveeiN
00499891   1/1  ------------------------------------dpikiGvllplsGplaalgkailngaelaveeiN
00453521   1/1  ------------------------------------dtikiGvllplsGpaaalgksilrgaelaveeiN
00466411   1/1  -----------------------------laaaaaagdikIGvlfpltslplftdlpelllcgplaalgy
00394931   1/1  -------------------------------aaalpgdikiGvllpltgdyafsgrrvllalelAveein
00365371   1/1  ------------------------------------gdikiGvllpltgtlasiggarvapAvelAveei


                         -         -         *         -         -         -         -:140
query           AAGGVLGKKIKFNVMDNKSDATEAANVATRLITQDKVVAVMGAATSGNTMGFMQVATDNKVPIITPSGTA
00489961   1/1  aaGGvlGrkielvveDdqsdpdraaaaarklvdqdgvdavvGpvssgvalavapvaeeagvplispsata
00499891   1/1  aaggilGrklelvvaDdqsdpakavaaarkli.ddgvdavvGplssgvalavapvaeeagiplispsats
00453521   1/1  aaggilGrklelvvlDdasdpekavaaarklv.ddgvdaiigplssgvalavapvaeeagvplispaata
00466411   1/1  qillaaelAveeiNanggllpgikLglviydtcgdpavavaaalklisstllsslvwlsgqgelipnysc
00394931   1/1  adgllvlsllpgvtlelvvldtecdpstllalaaaldlilsdgvdaiiGpscsssaaavarlaslwniPl
00365371   1/1  nadglllpgytlelvvldtesslgicdpsealaaavdllltdgvdaiiGpacsyvaiavarlasewniPl


                         +         -         -         -         -         *         -:210
query           LEVTVDPNTKKVRDYVFRTCFIDPFQGIVMANFATNDLKAKTAVLYVDNQSPYAKGLAQFFKDSFIKQGG
00489961   1/1  palt........spyvfrtgasdsqqaaaladylaklggkkvallyad..yaygrgladafkkalkalGg
00499891   1/1  palt.....degspyvfrtgpsdsqqaaaladylakklgakkvallysd.daygrgladafkkalkaagg
00453521   1/1  pdltd.....egspyvfrtgpsdsqqaaaladylakklgakkvaliy.pddaygrglaegfkkalkkagg
00466411   1/1  rdltlyddgvvaviGpassgvslavaplaelykiPqisygatspsls....dkdqypyffrtvpsdssqa
00394931   1/1  isygatspafl....sdkskyptllrtvpsdtslaealvall.khfgwkrvalvysd.ddygedcrglle
00365371   1/1  isygatsp....alsdksryptffrtvpsdtkqgdalvell.khfgwkrvallys.dddygegedcffla


                         -         -         -         +         -         -         -:280
query           KIVGEEAFMPEDQDFKATLTKIKGLNPDVIYVPAYYEPVGKIVKQGREIGITVPFLGGDGWDSPKLPEIA
00489961   1/1  evvgeeyyplgtttedfsaqltkikaagpdavflagygadaalflkqareaglkakvplvgslglaspel
00499891   1/1  evvgeeyyplgatdfsaqllkikaagpdavvlagygadaalflkqarelglkvpllgsdglaspellela
00453521   1/1  kvvaeeyyplgatdfsallaklkaagpdavvlagsgadaalflkaareaGlkvpiigtdglaseellela
00466411   1/1  ralaell.khfgwkwvaliys.dddygeglldafkealekagicvafvekipvsldagdtdfsailtkik
00394931   1/1  aleealekrgitvafvemiplgdtdfrallkkiks.karviilcgssedarellraaaelgltggeyvwi
00365371   1/1  ealekaleargitvvfvelipdadeadfralLqkiks.karviilcgsgeearlllkaarelgltggeyv


                         -         *         -         -         -         -         +:350
query           GGAALNNTYFSNHYSSQKDDPEIKGFVEKYQAKFGQVPDTFAALGYDTAVLLVDAIKRSEDASPEKIKEA
00489961   1/1  lklag.daaeGvlvtapyfpdldtpankafveaykakyggdappsafaaaaYdavlllaeAlekagsldr
00499891   1/1  g.daaegvlltapyfpd.dtpankafveaykakyggppsafaalaydavlllaealekagsldrealraa
00453521   1/1  g.eaaeGvllaapyfp.ldtpankafvkaykkkygdppsafaalaydavlllaealekag..dreallaa
00466411   1/1  askarvivvfgsgddaalllrqarelgltggyvwigtdgwdtsdlldelagdaaegvlgfsphsp..eip
00394931   1/1  ltdlllssldledfwyagdgtdekaleafegvlgvtllsp..dspefkeflqkvkarfgeppfncsllvs
00365371   1/1  filidllassllvdlagkaaegwlgtdgldeeareayegvltitlysp..dnpeykefvervkarakkep


                         -         -         -         -         *         -         -:420
query           LANAKDVQAITGKLSFDENHNPIKGAVILEMKDGKQVYKTYVQP--------------------------
00489961   1/1  eavraaleglk.fdgltGpvtfdpnghqavkdvylvqvk-------------------------------
00499891   1/1  legl.dfdgvtgpvtfdpnghqalgpvylvqvkdgkfvvvg-----------------------------
00453521   1/1  legl.dfdgvtgpvtfdpnghlgvravyivqvkggkfvlvg-----------------------------
00466411   1/1  gfkeflkalkpryypediflkefwelyfncslsalslsnckl----------------------------
00394931   1/1  tyaallydAvyllahAlhelllqgggsldgtklleal---------------------------------
00365371   1/1  fncledelvsayaaylyDAvylyalAlnealsdggdvvdgak----------------------------