[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50761.1


[Show Plain Result]

## Summary of Sequence Search
   1::227
  93::214  4.4e-28 50.0% 0045988 00459881 1/1   nosyl-L-methionine-dependent methyltran 
 100::217  1.6e-24 50.6% 0036976 00369761 1/1   nosyl-L-methionine-dependent methyltran 
 100::215  9.7e-23 42.7% 0037952 00379521 1/1   nosyl-L-methionine-dependent methyltran 
   1::227


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDKLKMHSINKVEDNIKKIGELFPNAITEVIKGYREDGSPIIEQAIDFDVLRQELSSVLVEGPAERYQFT
00459881   1/1  ----------------------------------------------------------------------
00369761   1/1  ----------------------------------------------------------------------
00379521   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           WPDKRKSILLANAPIAKTLRPYREESVDFDNTENLYIEGDNLDALKLLQETYLGKVKMIYIDPPYNTGND
00459881   1/1  ----------------------dieegdlfslglnllingDnlevlklLpd...gsvdliytDPPYntgk
00369761   1/1  -----------------------------elgrnllilgDnldvlkllpd...gsvdlivtDPPYntgkd
00379521   1/1  -----------------------------nlgnnlliqgDsldvlkllpd...gsvdlivtDPPYntgkd


                         +         -         -         -         -         *         -:210
query           FIYEDDFAQDADEYLANSGQYDENGNRLVQNTESNGRFHTDWLNMIYPRLKLAKDLLTEDGAIFISIDDN
00459881   1/1  dysy.dn..............................lshseyleflyerlkearrvLkpdGsifvnigd
00369761   1/1  y..................................ndsledylefleerlkearrlLkpdgsifvfiddk
00379521   1/1  y...............................dddllsleeyleflrerlkearrlLkpgGslfvfigdp


                         -         -         -         +         -         -         -:280
query           EVENLNLKSESSFPSLT-----------------------------------------------------
00459881   1/1  nela------------------------------------------------------------------
00369761   1/1  elaglkl---------------------------------------------------------------
00379521   1/1  elarl-----------------------------------------------------------------