[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50766.1


[Show Plain Result]

## Summary of Sequence Search
   1::80
   5::80     5e-19 52.1% 0047953 00479531 1/1   hog/DD-peptidase                        
   1::80


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEELFKLASNYRCPPHNRAVGGAVNSLHLKGMAADIRVLEMTAKEITHLAEKAGFDGIGLYPSQCFVHVD
00479531   1/1  ----itvtsgYRspelnaalggaknSqHllGlAaDivvpgvslaelarlaldlgfggvglypg..fvhvd


                         -         -         *         -         -         -         -:140
query           VRGYCARWEG------------------------------------------------------------
00479531   1/1  v.gyvrswgl------------------------------------------------------------