[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50796.1


[Show Plain Result]

## Summary of Sequence Search
   1::200
   3::110  2.6e-29 43.9% 0041988 00419881 1/1   2 domain of RNA polymerase sigma factor 
  12::86   1.5e-24 45.3% 0038400 00384001 1/1   2 domain of RNA polymerase sigma factor 
 117::187  3.7e-18 42.3% 0049224 00492241 1/1   3 and sigma4 domains of RNA polymerase  
 120::187  3.7e-17 47.1% 0041987 00419871 1/1   3 and sigma4 domains of RNA polymerase  
  96::187  3.9e-17 30.4% 0039239 00392391 1/1   3 and sigma4 domains of RNA polymerase  
 122::187  1.6e-16 33.3% 0049340 00493401 1/1   3 and sigma4 domains of RNA polymerase  
 120::187  2.6e-16 35.3% 0051096 00510961 1/1   3 and sigma4 domains of RNA polymerase  
 120::188  1.4e-12 31.9% 0049695 00496951 1/1   3 and sigma4 domains of RNA polymerase  
   9::90   1.6e-11 32.9% 0043329 00433291 1/1   2 domain of RNA polymerase sigma factor 
   4::91   3.6e-10 28.4% 0047881 00478811 1/1   2 domain of RNA polymerase sigma factor 
   4::91   6.5e-09 27.3% 0039240 00392401 1/1   2 domain of RNA polymerase sigma factor 
 133::188  1.9e-08 33.9% 0049651 00496511 1/1   3 and sigma4 domains of RNA polymerase  
 116::198  1.8e-07 35.0% 0048694 00486941 1/1   minal effector domain of the bipartite  
 126::198   0.0006 32.9% 0051317 00513171 1/1   minal effector domain of the bipartite  
   1::200


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLEDQLLVERSKKGDREAFEHLVRLYENKVYTIAYRLMGNHADASDLAQDAFIKIYQALPNFRGDSSFS
00419881   1/1  --mpllseeedeellaraqkgdeeafeelverylpllyrlarrllgd.adaeDlvQevflrlwraldkfd
00384001   1/1  -----------aksgdeaafeellrryrprllrlalrllgdradaeDlvQetflralraldsfrgiasfr
00492241   1/1  ----------------------------------------------------------------------
00419871   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------
00493401   1/1  ----------------------------------------------------------------------
00510961   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00433291   1/1  --------lrlakagdleareklieaylplVvsiakrylgrlpsgldleDliqeGligLlkAierFdpek
00478811   1/1  ---eelllleralegdeeareeLieanlrlVvsiAkkytnrgleleDLiqeGniGLikAvekFdpsrgyk
00392401   1/1  ---eellllellldgdeaareklieanlrlVvsiAkkylnrgldleDLiqeGniGLikAvekFdpskgvk
00496511   1/1  ----------------------------------------------------------------------
00486941   1/1  ----------------------------------------------------------------------
00513171   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TWIYHITVNVCRDELRKRQRRPTVSLDDNSSDSNNSNTYEIRSNDPGPEEMLDRSETQAMIQACLNTLSD
00419881   1/1  pgssfstWlyriarnlaidylrrrkrrvrlpldlleelee------------------------------
00384001   1/1  aWlyriarnlaidllR------------------------------------------------------
00492241   1/1  ----------------------------------------------speelleleellelllealdkLpe
00419871   1/1  -------------------------------------------------eallalellllllralerLpe
00392391   1/1  -------------------------lpvgddddlelldllpdddapspeelleaeelrellleaLekLpe
00493401   1/1  ---------------------------------------------------ektlelnlLldfylelLpe
00510961   1/1  -------------------------------------------------elekllelnllldfylelLte
00496951   1/1  -------------------------------------------------elleeellrelleealetLse
00433291   1/1  gvkFstYavlwirgaildyl--------------------------------------------------
00478811   1/1  FsTYAtwwIrqailrairdqs-------------------------------------------------
00392401   1/1  FstYAtwwIrgailrairdqs-------------------------------------------------
00496511   1/1  --------------------------------------------------------------eaLslLte
00486941   1/1  ---------------------------------------------lllelllllllllalllaalalLtp
00513171   1/1  -------------------------------------------------------lllldllallllLtp


                         +         -         -         -         -         *         -:210
query           DYREIIVMREIQELAYEEIAEILGCSLGTVKSRLSRARQALKEKISKQMELITPAKRLAK----------
00419881   1/1  ----------------------------------------------------------------------
00384001   1/1  ----------------------------------------------------------------------
00492241   1/1  rerevlllryleglslkeiAeilgisvgtvksrlarAlkkLrellee-----------------------
00419871   1/1  rqrevlllryleglsyeeiAeilgisvgtvksrlsrArkkLrellee-----------------------
00392391   1/1  rerevlrlryGlldlegltleeiAeilgvsrerVrqiesrAlkkLrk-----------------------
00493401   1/1  kqrevlelyyledlslkEIAeilgisrqaVkdllkralkkLreylek-----------------------
00510961   1/1  kqrevlllyyledlslkEIAeilgisrqaVkdrlkralkkLreylek-----------------------
00496951   1/1  rerevlrlryGlldlegltleeiAevlgvsrerVrqiekralkkLrka----------------------
00433291   1/1  ----------------------------------------------------------------------
00478811   1/1  ----------------------------------------------------------------------
00392401   1/1  ----------------------------------------------------------------------
00496511   1/1  rerevlrlryglddgedltleeiaellgisrervrqiekralkkLrkl----------------------
00486941   1/1  rErevlrl.laeGlsnkeIAerlgisekTVkthlsrilrKl..gvrnraelvalalrl------------
00513171   1/1  rElevlrl.laeglsnkeIAellgisekTVkthlsrilr..Klgvrsraelvalalel------------