[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50877.1


[Show Plain Result]

## Summary of Sequence Search
   1::233
   1::229  6.7e-77 49.8% 0049527 00495271 1/1    I glutamine amidotransferase-like      
   1::226  4.2e-42 32.2% 0039782 00397821 1/1    I glutamine amidotransferase-like      
   2::219    1e-37 30.7% 0047771 00477711 1/1    I glutamine amidotransferase-like      
   1::231    2e-37 31.1% 0047949 00479491 1/1    I glutamine amidotransferase-like      
   1::225  3.2e-35 31.2% 0042648 00426481 1/1    I glutamine amidotransferase-like      
   4::232  4.3e-32 24.3% 0050138 00501381 1/1    I glutamine amidotransferase-like      
   1::231  7.5e-32 31.0% 0039988 00399881 1/1    I glutamine amidotransferase-like      
   1::233  1.4e-29 31.3% 0043181 00431811 1/1    I glutamine amidotransferase-like      
   1::230  4.9e-29 30.2% 0050645 00506451 1/1    I glutamine amidotransferase-like      
   1::231  1.8e-28 31.0% 0047324 00473241 1/1    I glutamine amidotransferase-like      
   1::231    2e-28 28.3% 0047286 00472861 1/1    I glutamine amidotransferase-like      
   1::229  2.7e-28 28.9% 0048482 00484821 1/1    I glutamine amidotransferase-like      
   1::231  5.5e-27 28.6% 0049298 00492981 1/1    I glutamine amidotransferase-like      
   5::234    1e-26 28.8% 0045752 00457521 1/1    I glutamine amidotransferase-like      
   2::226  9.7e-26 22.8% 0051742 00517421 1/1    I glutamine amidotransferase-like      
   1::228  5.6e-24 23.7% 0042722 00427221 1/1    I glutamine amidotransferase-like      
   1::118  2.8e-23 33.9% 0041867 00418671 1/1    I glutamine amidotransferase-like      
   1::114    2e-21 35.4% 0042074 00420741 1/1    I glutamine amidotransferase-like      
   1::129  1.7e-20 32.8% 0037903 00379031 1/1    I glutamine amidotransferase-like      
   1::234    3e-17 23.0% 0038211 00382111 1/1    I glutamine amidotransferase-like      
   1::100  3.6e-17 34.7% 0042273 00422731 1/1    I glutamine amidotransferase-like      
   1::100  7.2e-14 29.5% 0049495 00494951 1/1    I glutamine amidotransferase-like      
   1::102  1.1e-13 32.3% 0046884 00468841 1/1    I glutamine amidotransferase-like      
   1::164  1.4e-12 23.3% 0048285 00482851 1/1    I glutamine amidotransferase-like      
   1::100  1.3e-10 34.7% 0051738 00517381 1/1    I glutamine amidotransferase-like      
   1::100  4.1e-10 30.4% 0052668 00526681 1/1    I glutamine amidotransferase-like      
  38::100  1.1e-09 43.1% 0049828 00498281 1/1    I glutamine amidotransferase-like      
   1::100    4e-07 28.0% 0046130 00461301 1/1    I glutamine amidotransferase-like      
   1::230  0.00067 21.9% 0051730 00517301 1/1    I glutamine amidotransferase-like      
   1::233


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFGVVVFPGSNCDADCLHAIKTVTGQPVDYIWHKSGSVDGYDCIVLPGGFSYGDYLRCGAVARFSPVMS
00495271   1/1  ilplakpkvavlvfpgsncdrdlarafera.GfeavlvhmsdllagrvllddfdglvlpGGfsygdvlgg
00397821   1/1  gallkvivivdygsgnlrdlaralrel.gvevevvpidedillldadglilPGggstvddlr...llrle
00477711   1/1  -kiivivdpgsgnlrdiaralrel.gvevevvrdpe.dledadgiilpGgfstrgdlr...llrlsglie
00479491   1/1  agkpvigvlpglvprilvldygsgnlyrsiaralrea.GaevvvvpvdltleeipellddadglilpGGp
00426481   1/1  lkaldgvkiavldfggnytsll...ralrelgaevvvvssled.legadglilpGGfstvdllll....r
00501381   1/1  ---mgkpvigilgkyillldaydsvtaalylagrllgvgv..evvvvgadv.ltleeipellddadglvl
00399881   1/1  mkilvidlggsnle.slvdalrel.gaevevvrvdvldeedledadalilPGggspadalrll...rleg
00431811   1/1  kmkiavldfggnytsll..ralrea.gaevvvvsp.dedledadglilpGGpgtvyal....llrdegll
00506451   1/1  mkilvldfggsnle.slaralrel.gaevevvpvd.ldleeillldadglilpGGpsvgda.........
00473241   1/1  mkilvldfygsnte.slvralre.lgaevevvpvdleletlpeelllldpdglilpGGpgspdllg....
00472861   1/1  mk.vllldygdsfteslaralrelgaevevvpvdlelletldeidlldpdglilpGGpgsvgde......
00484821   1/1  mmkmkilvldlpgsgnlqsiaralre.agvevvvvpaddltldeilledadglilpGG..pgdpldlgal
00492981   1/1  kkevkiavvgdygsltgnllsilealeha.gaevvvkveilwvpsdlleeeilellkgadgillpGGpgd
00457521   1/1  ----leglgllelvlvlllldlleldlvawvsllelllnpggevriavidygsfynilralre.lgaeve
00517421   1/1  -aevligvlildggvgnhisvlaalerlgvev.vvvrkpedlkdidglilPGggsttialla.llarigl
00427221   1/1  mkkiliidfgdsflynlvralre.lgvevvvvpvdaltleeilllnpdglilpGGpgspydarde.....
00418671   1/1  alllskrlsllllllllkllaskkilvllfdgfedlelvgpldalrragaevvvvspdgglpvvgshgll
00420741   1/1  mkkvlvllagggvldgfellEavlpldaLrra.gaevtvaspdggqvhvvnhllgelegenrnvvvesag
00379031   1/1  kkilvllfdgfellelasplralrea.gaevevvspdggpvtssnglalladltldevdledyDalilpG
00382111   1/1  ialvgkkilildfggsften.lvralre.lgvevevvpvdadlleillldpdglilpGGpgsp.......
00422731   1/1  mmkkvlvllfdgfellelvgpldvlrragyevtvvspdgglpvtsslgltvlpdatlddldpledyDalv
00494951   1/1  lkmkkvaillfdgfellelagplevlraagyevtlvspdggpvtssnglrlaadatlddvdledyDalvv
00468841   1/1  mkkllliggfrgdlslleplldllelltgdkpkigvipyagldldfegyyrsvldalerlGaevvvvsll
00482851   1/1  esklplpdlaednalfpsllslskllsslllleglllplllllmkkvlvvltsagvlmkkvlillfdgfe
00517381   1/1  mkkvlvlladgfellelagpldvLrragyevtvaspdggqlppvttslgltvladatlddvdaedyDalv
00526681   1/1  pkkvlvllfdgf.ellelagpldvLrrangyevtlvspdggpvtssggltvlpdatlddvdpedyDalvv
00498281   1/1  -------------------------------------dlddydalvlPGGhgtaddlrd.....deelle
00461301   1/1  lmgkkvaillfdgfellelagplevlraagyevtlvspdggpvtssngltlaadatlddvdaadyDalvv
00517301   1/1  mlkiliidfgdsftgsivralrel.gvevevvpndadleelle.pdgiilsGG........pgspadegl


                         -         -         *         -         -         -         -:140
query           PVIEFARRGGLVLGICNGFQVLTEAGLLPGALHRNKNLSFLCHDTYLRVENDISPFTSLASRGSVIKVPI
00495271   1/1  gaiaaasllmndklelallkffarrgkpvLGiCnGfQlLvelgllpggdlldpaltrnasgrfesrwvtl
00397821   1/1  glieairealeagkPvLGIClGmQlLaealggpgsvpglgllpgkvvrnkegrlvvphlgwnvvvl..ds
00477711   1/1  airealergiPvLGIClGmQlLaealggpvgleglgllgggvlllgtlrlphmgwnll......elplll
00479491   1/1  sdvddl..galrrdegllelirealergdlkPvlGIClGmQlLaea..lggkvikgpggee.gvvvpvel
00426481   1/1  nsglleaireaaeagkPvlGiClGlqlLaealggpg........vpglgllpgkverlalgrtvlslvgd
00501381   1/1  pGGpgspddlg.........lleairealergkpvlGIClGmQllaea..lggkveklpgaelglldpev
00399881   1/1  lieaireaaesgkpvlGIClGmqlLaealggkvgvpglglldgktvrlykgrlphvgvn.........gp
00431811   1/1  eaireaaeagkpvlGiClGmqlLaealggkvvkglgllpgkvvteyrgltlpvvgad.............
00506451   1/1  .glleairealealgkpvlGiClGmqllaea..lggkvvrlk..vpehgwvsviltdg.splfkglgde.
00473241   1/1  .....lleairealeagvpvLGiClGhQllaea..lggkvlrlktgelgwnsvvlteg...splfkgl..
00472861   1/1  ....glieairealeagvpvLGiClGhQllaea..lggkvlrlktgrlgwnsvvlteg...splfkgl..
00484821   1/1  prieglielirealeagkpvlGIClGhQlLae..alggkverlpegpelgllpvevt.eg..splfrglg
00492981   1/1  pg.........veglieairealengiPvLGIClGmQllavalggnvlglkdahsgefseetnhpvlgll
00457521   1/1  vvpvdidaeelealdpdglilpGG........pgdprrleglieairealeagkPvlGIClGhQllaea.
00517421   1/1  llalikfviakgkpvlGiClGmQlLaeasgepgvleglgeigglgllditvvrnafgrqphsgwndlkik
00427221   1/1  .gllelirealeagkPilGIClGhQllala..lggkvlklkvgelgwnsvvltlvtdgsllfkgl..gde
00418671   1/1  vvtadttlddvdledyDalvlPGGfga.ddlrad.....eellelire----------------------
00420741   1/1  ialvadltladvdladyDalvlPGGfgaaknlrdgaiagellrv--------------------------
00379031   1/1  Gpgtvdllrd......pgllelireaaeagkpvlgiClGaqlLaeagllggkvatthwl-----------
00382111   1/1  ..rdeglielirealeagkPvlGiClGmQllala..lggkvlklkvpelglnsvvlvld.....gglfeg
00422731   1/1  lpGgfgaaddlrd.....dpallellrefa----------------------------------------
00494951   1/1  pGgfgaaddl.....aadpallallrefaa----------------------------------------
00468841   1/1  edpleaLpdaDglilpGGntfalldllr....--------------------------------------
00482851   1/1  llElagpldvLrragyevdlaspdggpvpldplsvnildlgvksnfrnvlssaglaltpdaslddvdlPe
00517381   1/1  lPGglgaaddlrd.....dealldllrefa----------------------------------------
00526681   1/1  pGglg.......palrldpallallrefae----------------------------------------
00498281   1/1  llrefaeagkpvaaiChGpalLaaaglsdg----------------------------------------
00461301   1/1  pgg.gaedlad......dpallallreaaa----------------------------------------
00517301   1/1  llialiklalelgiPiLGiClGhQllal..alggkvvklkvge...........................


                         +         -         -         -         -         *         -:210
query           AHGEGNYFADSDTVRRLEENNQVVFRYCDYNGEITQGVNPNGSVNNIAGICNEQGNVLGMMPHPERCAEE
00495271   1/1  rvenspsiflsgl.agsvlpvpvaHgegvfeladdlvlaaleedgqvalrYvdndgnpteeyPlNPnGsl
00397821   1/1  plfkglgeelrvyeiHsyavevnd.etlellpegllvlattedgg..............viagaavekgn
00477711   1/1  gigegvygyevhsyrtlpnglavlaltedg...............viagaavrdgnvlGvqfHPEfssdp
00479491   1/1  lglllvstlflglpspllkgs.llapiaygvhsyevneihgdaveelpeglvvlat...........spd
00426481   1/1  lllpglgwnlrgyeihadlveglpegaevlavh.dg.................agaavrkgnvlgvqfHp
00501381   1/1  tr.nvvglleesfvlvellgvphlgwnpvalaegsllfkglgeeliverhrhryevhsdavdrllpegle
00399881   1/1  lfkglpdpltvyeiHslrvev........lpdgllvlars...dg.............liegiehkdgnv
00431811   1/1  ....alfvglevvvhgyevhsdaveelpeglevlats............ddg....ieaie..hgnvlgv
00506451   1/1  .ltvyfsHsyav........delpeglevlat............sedgs...ieaielkdgpvlgvqfHP
00473241   1/1  gdvlivyfsHgyavde........lpeglevlats.dg...............tieaielkdgpvfgvqf
00472861   1/1  gdvlivyfsHsyavte........lpeglevlats.dg...............tieaielkdgpvlgvqf
00484821   1/1  de..lrvyeiHsd.vtelp....................eglevlatsedgs...ieairhkd..vlgvq
00492981   1/1  pglvlrnallelvdslsdlggtmrlGwhpvvlveg.sllfkgygkgl....iivrhrHsyavdplylpll
00457521   1/1  .lggkvvrlkvghsge..........nsplfkglg.gdviivyhsHgyavn......leslpeglevlat
00517421   1/1  glsplfkgilnksi........fyfvhsyirapliedvgvtvavlsyggefiaavrkgnilGtqFHPEls
00427221   1/1  livyfyHsyavde........lpeglevlatslddgl..............veaiehkdlpvfgvQfHPE
00418671   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00382111   1/1  lpgtlrlyfyhslivrhshgdavnelpeglvvlats.ddgl..............veaiehkdlpvfgvQ
00422731   1/1  ----------------------------------------------------------------------
00494951   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00482851   1/1  dyDalilPGGfgaaddlrd.....----------------------------------------------
00517381   1/1  ----------------------------------------------------------------------
00526681   1/1  ----------------------------------------------------------------------
00498281   1/1  ----------------------------------------------------------------------
00461301   1/1  ----------------------------------------------------------------------
00517301   1/1  ...lgwnsvvltlgsplfkglgevlivyfyHsyavdelpeglevlatsddgpveairhkdlpifgvQfHP


                         -         -         -         +         -         -         -:280
query           ILGNIDGQLIFKSLLETWQRRCG-----------------------------------------------
00495271   1/1  ngiagitsedgrvlglmpH---------------------------------------------------
00397821   1/1  vlgvqfHPEk......------------------------------------------------------
00477711   1/1  glrlllnfl-------------------------------------------------------------
00479491   1/1  gsveaiegidhkdgnvlGvQf-------------------------------------------------
00426481   1/1  e.....lsgdprglr-------------------------------------------------------
00501381   1/1  vlatspdgngsllglieaiehk------------------------------------------------
00399881   1/1  lGvqfHPefs......seagl-------------------------------------------------
00431811   1/1  qfHpefts........glrllrn-----------------------------------------------
00506451   1/1  Eftsg.....plglrllrnf--------------------------------------------------
00473241   1/1  HPEl.....sltplglrlfrn-------------------------------------------------
00472861   1/1  HPEls.....ltplglrlfrn-------------------------------------------------
00484821   1/1  fHPE......fdsddglrl---------------------------------------------------
00492981   1/1  eeeglvvtat...........-------------------------------------------------
00457521   1/1  ............slndgl..veai----------------------------------------------
00517421   1/1  gdtglheylldlvkea------------------------------------------------------
00427221   1/1  ss.....lgplglallkn----------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00382111   1/1  fHPEsts.....gplglrlfrnfl----------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00494951   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00482851   1/1  ----------------------------------------------------------------------
00517381   1/1  ----------------------------------------------------------------------
00526681   1/1  ----------------------------------------------------------------------
00498281   1/1  ----------------------------------------------------------------------
00461301   1/1  ----------------------------------------------------------------------
00517301   1/1  Ev....tstplg.lrllknF--------------------------------------------------