[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50885.1


[Show Plain Result]

## Summary of Sequence Search
   1::513
 188::406  1.1e-63 42.9% 0039538 00395381 1/1   ne nucleotide alpha hydrolases-like     
 184::435    8e-62 36.8% 0045391 00453911 1/1   ne nucleotide alpha hydrolases-like     
   7::228  2.7e-59 33.2% 0047949 00479491 1/1    I glutamine amidotransferase-like      
   8::198  7.3e-56 34.0% 0038211 00382111 1/1    I glutamine amidotransferase-like      
 199::392  1.9e-55 36.8% 0047035 00470351 1/1   ne nucleotide alpha hydrolases-like     
   6::201    2e-55 35.6% 0051730 00517301 1/1    I glutamine amidotransferase-like      
   6::189  4.8e-54 32.6% 0042722 00427221 1/1    I glutamine amidotransferase-like      
   8::195    1e-52 34.4% 0050645 00506451 1/1    I glutamine amidotransferase-like      
   7::195  3.4e-51 31.9% 0047286 00472861 1/1    I glutamine amidotransferase-like      
   9::236  4.2e-51 34.4% 0048482 00484821 1/1    I glutamine amidotransferase-like      
 393::513  5.1e-50 64.5% 0047036 00470361 1/1   ynthetase C-terminal dimerisation domai 
   9::196  1.5e-49 32.8% 0047324 00473241 1/1    I glutamine amidotransferase-like      
 217::436  1.1e-48 32.5% 0052117 00521171 1/1   ne nucleotide alpha hydrolases-like     
   8::196  2.1e-48 29.6% 0050138 00501381 1/1    I glutamine amidotransferase-like      
 184::440  5.8e-48 30.2% 0050739 00507391 1/1   ne nucleotide alpha hydrolases-like     
   8::198  2.1e-46 34.6% 0045752 00457521 1/1    I glutamine amidotransferase-like      
   7::209  7.8e-46 32.0% 0039782 00397821 1/1    I glutamine amidotransferase-like      
 190::415  6.1e-44 33.3% 0046213 00462131 1/1   ne nucleotide alpha hydrolases-like     
 199::469  9.2e-42 29.3% 0051038 00510381 1/1   ne nucleotide alpha hydrolases-like     
   6::201  3.1e-41 35.9% 0043181 00431811 1/1    I glutamine amidotransferase-like      
 195::416  4.4e-40 31.7% 0050746 00507461 1/1   ne nucleotide alpha hydrolases-like     
 204::399  5.2e-40 30.0% 0049476 00494761 1/1   ne nucleotide alpha hydrolases-like     
   9::199  2.1e-39 32.2% 0042648 00426481 1/1    I glutamine amidotransferase-like      
   7::195  5.7e-37 29.0% 0039988 00399881 1/1    I glutamine amidotransferase-like      
   7::188  8.7e-35 28.8% 0047771 00477711 1/1    I glutamine amidotransferase-like      
   4::200  5.7e-34 24.9% 0049298 00492981 1/1    I glutamine amidotransferase-like      
 206::415  1.1e-32 30.8% 0048369 00483691 1/1   ne nucleotide alpha hydrolases-like     
   9::197  2.7e-28 29.1% 0052900 00529001 1/1    I glutamine amidotransferase-like      
 219::382  5.4e-28 32.2% 0047848 00478481 1/1   ne nucleotide alpha hydrolases-like     
 199::436    7e-26 27.1% 0048858 00488581 1/1   ne nucleotide alpha hydrolases-like     
 218::382  1.6e-24 30.5% 0050233 00502331 1/1   ne nucleotide alpha hydrolases-like     
   1::191  3.5e-23 20.5% 0049527 00495271 1/1    I glutamine amidotransferase-like      
 209::389  3.6e-23 24.6% 0039977 00399771 1/1   ne nucleotide alpha hydrolases-like     
   7::145  1.7e-20 27.7% 0037903 00379031 1/1    I glutamine amidotransferase-like      
 216::381  2.5e-15 30.3% 0050128 00501281 1/1   ne nucleotide alpha hydrolases-like     
   9::175    2e-14 22.8% 0051742 00517421 1/1    I glutamine amidotransferase-like      
 207::286  2.7e-06 28.6% 0051645 00516451 1/1   ne nucleotide alpha hydrolases-like     
   6::174  8.1e-06 22.9% 0046884 00468841 1/1    I glutamine amidotransferase-like      
 216::387  0.00033 20.7% 0052363 00523631 1/1   ne nucleotide alpha hydrolases-like     
   1::513


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLAEQELILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAPTV
00395381   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------
00479491   1/1  ------agkpvigvlpglvprilvldygsgnlyrsiaralreaGaevvvvpvdltleeipellddadgli
00382111   1/1  -------ialvgkkilildfggsftenlvralrelgvevevvpvdadlleillldpdglilpGGpgsprd
00470351   1/1  ----------------------------------------------------------------------
00517301   1/1  -----mlkiliidfgdsftgsivralrelgvevevvpndadleelle..pdgiilsGGpgspadegllli
00427221   1/1  -----mkkiliidfgdsflynlvralrelgvevvvvpvdaltleeilllnpdglilpGGpgspydardeg
00506451   1/1  -------mkilvldfggsnleslaralrelgaevevvpvdldleeillldadglilpGGp.svgdaglle
00472861   1/1  ------mkvllldygdsfteslaralrelgaevevvpvdlelletldeidlldpdglilpGGpgsvgdeg
00484821   1/1  --------mmkmkilvldlpgsgnlqsiaralreagvevvvvpaddltldeilledadglilpGGpgdpl
00470361   1/1  ----------------------------------------------------------------------
00473241   1/1  --------mkilvldfygsnteslvralrelgaevevvpvdleletlpeelllldpdglilpGGpgspdl
00521171   1/1  ----------------------------------------------------------------------
00501381   1/1  -------mgkpvigilgkyillldaydsvtaalylagrllgvgvevvvvgadvltleeipellddadglv
00507391   1/1  ----------------------------------------------------------------------
00457521   1/1  -------leglgllelvlvlllldlleldlvawvsllelllnpggevriavidygsfyn..ilralrelg
00397821   1/1  ------gallkvivivdygsgnlrdlaralrelgvevevvpid...edillldadglilPGggstvddlr
00462131   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00431811   1/1  -----kmkiavldfggnytsll.ralreagaevvvvspdedle.....dadglilpGGpgtvyalllrde
00507461   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00426481   1/1  --------lkaldgvkiavldfggnytsll.ralrelgaevvvvssled.....legadglilpGGfstv
00399881   1/1  ------mkilvidlggsnleslvdalrelgaevevvrvdvldeedle.dadalilPGggspadalrllrl
00477711   1/1  ------kiivivdpgsgnlrdiaralrelgvevevvrdpedle.....dadgiilpGgfstrgdlrllrl
00492981   1/1  ---kkevkiavvgdygsltgnllsilealehagaevvvkveilwvpsdlleeeilellkgadgillpGGp
00483691   1/1  ----------------------------------------------------------------------
00529001   1/1  --------senifvmsedralrqdirplrIllLnlmpkkidtevqflrllgaqplqveltllridshlsk
00478481   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  ilplakpkvavlvfpgsncdrdlaraferaGfeavlvhmsdllagrvllddfdglvlpGGfsygdvlggg
00399771   1/1  ----------------------------------------------------------------------
00379031   1/1  ------kkilvllfdgfellelasplralreagaevevvspdggpvtssnglalladltldevdledyDa
00501281   1/1  ----------------------------------------------------------------------
00517421   1/1  --------aevligvlildggvgnhisvlaaler....lgvevvvvr.kpedlkdidglilPGggsttia
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  -----mkkllliggfrgdlslleplldllelltgdkpkigvipyagldldfegyyrsvldalerlGa..e
00523631   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DPAVYELDIPVLGICYGMQLMTQQLKGKVVPAEMREYGRTTLRVMQCDNILKNLTADEECWMSHGDRVEE
00395381   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------
00479491   1/1  lpGGpsdvddlgalrrdegllelirealergdlkPvlGIClGmQlLaealggkvikgpggeegvvvpvel
00382111   1/1  eglielirealeagkPvlGiClGmQllalalggkvlklkvpelglnsvvlvldgglfeglpgtlrlyfyh
00470351   1/1  ----------------------------------------------------------------------
00517301   1/1  aliklalelgiPiLGiClGhQllalalggkvvklkvgelgwnsvvltlgsplfkglgevlivyfyHsyav
00427221   1/1  llelirealeagkPilGIClGhQllalalggkvlklkvgelgwnsvvltlvtdgsllfkglgdelivyfy
00506451   1/1  airealealgkpvlGiClGmqllaealggkvvrlkvpehgwvsviltdgsplfkglgdeltvyfsHsyav
00472861   1/1  lieairealeagvpvLGiClGhQllaealggkvlrlktgrlgwnsvvltegsplfkglgdvlivyfsHsy
00484821   1/1  dlgalprieglielirealeagkpvlGIClGhQlLaealggkverlpegpelgllpvevtegsplfrglg
00470361   1/1  ----------------------------------------------------------------------
00473241   1/1  lglleairealeagvpvLGiClGhQllaealggkvlrlktgelgwnsvvltegsplfkglgdvlivyfsH
00521171   1/1  ----------------------------------------------------------------------
00501381   1/1  lpGGpgspddlglleairealergkpvlGIClGmQllaealggkveklpgaelglldpevtrnvvgllee
00507391   1/1  ----------------------------------------------------------------------
00457521   1/1  aevevvpvdidaeelealdpdglilpGGpgdprrleglieairealeagkPvlGIClGhQllaealggkv
00397821   1/1  llrleglieairealeagkPvLGIClGmQlLaealggpgsvpglgllpgkvvrnkegrlvvphlgwnvvv
00462131   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00431811   1/1  glleaireaaeagkpvlGiClGmqlLaealggkvvkglgllpgkvvteyrgltlpvvgadalfvglevvv
00507461   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00426481   1/1  dllllrnsglleaireaaeagkPvlGiClGlqlLaealggpg..vpglgllpgkverlalgrtvlslvgd
00399881   1/1  eglieaireaaesgkpvlGIClGmqlLaealggkvgvpglglldgktvrlykgrlphvgvngplfkglpd
00477711   1/1  sglieairealergiPvLGIClGmQlLaealggpvgleglgllgggvlllgtlrlphmgwnllelplllg
00492981   1/1  gdpgveglieairealengiPvLGIClGmQllavalggnvlglkdahsgefseetnhpvlgllpglvlrn
00483691   1/1  ----------------------------------------------------------------------
00529001   1/1  ntaalhltrfyetfdlidlekfDgliitGgpvsvldfedvpwleelkellkwalenkkptLGiClGaqll
00478481   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  aiaaasllmndklelallkffarrgkpvLGiCnGfQlLv.elgllpggdlldpaltrnasgrfesrwvtl
00399771   1/1  ----------------------------------------------------------------------
00379031   1/1  lilpGGpgtvdllrdpgllelireaaeagkpvlgiClGaqlLaeagllggkvatthwleeee..lpeaga
00501281   1/1  ----------------------------------------------------------------------
00517421   1/1  llallariglllalikfviakgkpvlGiClGmQlLaeasgepgvleglgeigglgllditvvrnafgrqp
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  vvvvslledpleaLpdaDglilpGGntfalldllretglleaireavengkpvlGiCaGmqllgesildp
00523631   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPKGMEVLKSFLFDICGCSGSWSMGSFLDEAVK
00395381   1/1  -----------------------------------------------fvldiaglsedeavealrelled
00453911   1/1  -------------------------------------------vlknpildillvkldfdleeiiealve
00479491   1/1  lglllvstlflglpspllkgsllapiaygvhsyevneihgdaveelpeglvvlatspdgsveaiegidhk
00382111   1/1  slivrhshgdavnelpeglvvlatsddglveaiehkdlpvfgvQfHPEstsgplglrl------------
00470351   1/1  ----------------------------------------------------------eellerlveair
00517301   1/1  delpeglevlatsddgpveairhkdlpifgvQfHPEvtstplglrllknFlelalelkkdw---------
00427221   1/1  HsyavdelpeglevlatslddglveaiehkdlpvfgvQfHPEsslgplg---------------------
00506451   1/1  delpeglevlatsedgsieaielkdgpvlgvqfHPEftsgplglrllrnfl.eaa---------------
00472861   1/1  avtelpeglevlats.dgtieaielkdgpvlgvqfHPElsltplglrlfrnflea---------------
00484821   1/1  delrvyeiHsd.vtelpeglevlatsedgsieairhkd..vlgvqfHPE.fdsddglrllenfl.ellg.
00470361   1/1  ----------------------------------------------------------------------
00473241   1/1  gyavdelpeglevlats.dgtieaielkdgpvfgvqfHPElsltplglrlfrnfl.--------------
00521171   1/1  ----------------------------------------------------------------------
00501381   1/1  sfvlvellgvphlgwnpvalaegsllfkglgeeliverhrhryevhsdavdrllpe--------------
00507391   1/1  -------------------------------------------llenfivpilgvkldidleeiiealvl
00457521   1/1  vrlkvghsge.......nsplfkglggdviivyhsHgyavnleslpeglevlatslnd------------
00397821   1/1  l..dsplfkglgeelrvyeiHsyavevndetlellpegllvlattedggviagaavekgnvlgvqfHPE-
00462131   1/1  -------------------------------------------------rrywdlpfvp.dleellealv
00510381   1/1  ----------------------------------------------------------idleelieelve
00431811   1/1  hgyevhsdaveelpeglevlatsddg.ieaie..hgnvlgvqfHpefts...glrllrnfl---------
00507461   1/1  ------------------------------------------------------ekllkkllkkvekaik
00494761   1/1  ---------------------------------------------------------------skltlda
00426481   1/1  lllpglgwnlrgyeihadlveglpegaevlavhdg...agaavrkgnvlgvqfHpelsg-----------
00399881   1/1  pltvyeiHslrvevlpdgllvlars.dgliegiehkdgnvlGvqfHPefs.seag---------------
00477711   1/1  igegvygyevhsyrtlpnglavlaltedgviagaavrdgnvlGvqfHP----------------------
00492981   1/1  allelvdslsdlggtmrlGwhpvvlvegsllfkgygkgliivrhrHsyavdplylpllee----------
00483691   1/1  -----------------------------------------------------------------eeaik
00529001   1/1  ayalggkvkkalpgkefGvfpvtltddgdpllrglpdeftvphsrytehhddvielp-------------
00478481   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------rrYwdlpfldle
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  rvenspsiflsglagsvlpvpvaHgegvfeladdlvlaaleedgqvalrYv-------------------
00399771   1/1  --------------------------------------------------------------------ia
00379031   1/1  nvv..-----------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00517421   1/1  hsgwndlkikglsplfkgilnksifyfvhsyirap-----------------------------------
00516451   1/1  ------------------------------------------------------------------eilr
00468841   1/1  gglegaeggevpglgllpgvvvrhadgrqvdsfg------------------------------------
00523631   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EVKQRVGNRQVLCALSGGVDSSVAAVLVHRAVGDNLTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVD
00395381   1/1  avrrrlrgdvpvgvaLSGGvDSslvaalaaralgdvltftigfegldeleearavaehlgtehhevlitv
00453911   1/1  flrdyllksgakkvvlglSGGvDStvaaalakkalgrlplellgdellavtvdhglssdeedalelakkl
00479491   1/1  dgnvlGvQfHPEftsgpl----------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00470351   1/1  dylllvgdkkvvvglSGGvDSsvlaallkkalgyevlavtvdtgllrseeeledaeklaeklgiplivvd
00517301   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00484821   1/1  ...llplnylelllellre....dll--------------------------------------------
00470361   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00521171   1/1  ------lgggkkvvvllSGGvDSsvaaallkka.gyeviavhfdyglrtdelcvseeeledakklaeklg
00501381   1/1  ----------------------------------------------------------------------
00507391   1/1  flkdylrklsglkgvvlGlSGGvDSalaaalavralgllrlergllnlnvlavtmpsglssd..sledak
00457521   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00462131   1/1  ellrdavrkrlvgdkkvvvalSGGlDSsvlaallkeaggaegllfmknwdlddevlavtvdygq..sde.
00510381   1/1  llrdyvlkrggkkvvvalSGGvDSsvllallakalglevlavtvdtglrseeeledarela.eklgiplh
00431811   1/1  ----------------------------------------------------------------------
00507461   1/1  dykllvggdkvlvalSGGvDSsvllallkkllkrlpgyelvavhvdhglrgesdeelefvrelaek.lgi
00494761   1/1  llllpalllalcleklnelledlvaeeilrealeefg.dkvvvalSGGkDSsvllhlllka.glevlavh
00426481   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00483691   1/1  lfrllkkgdkvlvalSGGkDStvllhlllelarrllgfevvavhvdhglrgesdeelefvrelaeklgip
00529001   1/1  ----------------------------------------------------------------------
00478481   1/1  --------kkvvvalSGGlDSsvllallkealgyeviavtvdygq...reeleaarelakklgikphivv
00488581   1/1  eavealrellrdavrkrlvsdvpvgvlLSGGlDSslvaalaaralg.nvlaftvgfgq..sdeleyarev
00502331   1/1  -------kkkvvvalSGGlDSsvalallkea.gyeviavtvdlgqre...dleaarevakklgivplyvv
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  vlrrlmsgkkvvvalSGGlDSsvllallkel.gyeviavtvdlgqrhsed.leaarevaeklgikehhvv
00379031   1/1  ----------------------------------------------------------------------
00501281   1/1  -----gtsgkvlvllSGGiDSpvaayllmkr.Gvevialhfdlgpltleealevvklllkll........
00517421   1/1  ----------------------------------------------------------------------
00516451   1/1  ealeefd..rvvvsfSgGkDStvllhlalkalrpaglpipvvfldtgyl.fpetyefvdelaerlgldli
00468841   1/1  ----------------------------------------------------------------------
00523631   1/1  -----lklmkvvvlfSGGkDStlalylale.lghevvalltllpeeldsymfhtvnlelaklqAealglp


                         -         *         -         -         -         -         +:350
query           ASERFLGKLQGVTDPEQKRKIIGTEFIRVFEEEARKLGEIDFLVQGTLYPDVVESGTATAEVIKSHHNVG
00395381   1/1  dallaflpalagaldllepeakrkiipllllsraaregvkvvlsGegaDelfgGylyydvaesrallldl
00453911   1/1  gidhelvidivdavdaflaalegvtgpepkdktigniqarlrmvalyalanklgalvlgt..gdvsEtll
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00470351   1/1  ideeflealaelfgptpnpcnlcnrlrlelllelakel.gadvlatGtgaddeietgyltllgddgikdl
00517301   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00470361   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00521171   1/1  iplivvdldeifleilkkgetpn.pcvlcrrirlrillelaeel.gadviatGhnaddvadq........
00501381   1/1  ----------------------------------------------------------------------
00507391   1/1  alaealgiellvvdidpavdallkllgeagpelkdltlgniqarlRmvllyalanllgglvlgT..gnls
00457521   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00462131   1/1  ledarevaeklGiphhvvdideeevldalkdvidagetpnpcvlcrrlrlyllyelarelg.advvltG.
00510381   1/1  vvdidelfdalldllgagdtpnpcnicrrlrlrllyelakelg.advlltG.hadelfegylllrgdglk
00431811   1/1  ----------------------------------------------------------------------
00507461   1/1  plivvdvdelflaagngpnpcalcrrlrygallelakel.....gadvlatGhhadDqaetvlln...ll
00494761   1/1  vdtgll.fpetlefaeelaerlgiplivvdldeefaeflallgglsegdppnpcalcrrlklepllraak
00426481   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00483691   1/1  livvdldelf....kglnpcalarrlryaallevar.......gadalatGhhldDqaetvllnllrgs.
00529001   1/1  ----------------------------------------------------------------------
00478481   1/1  dldeeflselvdpaipagalyegnypltcvlcrnlifklllevaeel.....gadavatGhtaddlddv.
00488581   1/1  .aehlgiehhvvdideeelldalpdvlaaldtpepvnlrsrirlylla...rlark..gakvvltGegaD
00502331   1/1  dlseefaeevldpalkayalgegpypltvvlarnlifkalleiakelgadaiatGhtlddndev......
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  dvdlefvedvvltlideykagatpegdypltcalarnliflllaelaeelg.adviatGhtlkgadel..
00379031   1/1  ----------------------------------------------------------------------
00501281   1/1  ..............ekylcilckrlmlriaeklalklg.adaivtGeslgqvasq..........tlenl
00517421   1/1  ----------------------------------------------------------------------
00516451   1/1  vvrpde----------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00523631   1/1  livieisg.................eyedevedllellke..lgveavvtGdilsd............yq


                         -         -         -         -         *         -         -:420
query           GLPEDMKFDLVEPLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVT
00395381   1/1  lktlvddllvrvdrasmahglevrvPflDhrlvelalslppelklrggveKyllRe--------------
00453911   1/1  ....gyltkygdggld.......lrPlldlyKtevralarelglpeeiiekppsaeleplrpgqtdedsl
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00470351   1/1  syvlglpeelllklirPlldltkdevrelarelglpyailys----------------------------
00517301   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00470361   1/1  ------------------------------------------GPGLavrvlgevteekleilreadaivl
00473241   1/1  ----------------------------------------------------------------------
00521171   1/1  .tllnlyalnallglkilrPLlgldKeeirelakelglpe..iskypsggcgscflprnpftkallelle
00501381   1/1  ----------------------------------------------------------------------
00507391   1/1  Elalg....yftkyGdggld.......iaPladlyKtevrelarylgipeeildkpPsaeLepltpgqtd
00457521   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00462131   1/1  hgaDelfgGytkygdllkglaplgdlpkdqvyllarllg.llkreiralglelrvPfldeelv..-----
00510381   1/1  g...............irPlldlskeevrelarelglpeeilekppsadlgf.....gqldeellglpye
00431811   1/1  ----------------------------------------------------------------------
00507461   1/1  rgsglkglqgillgglrlirPLldltkdeireyakelglp...viedpsnadllfir..nrirell----
00494761   1/1  elg.adaiatGhrrddsaerallrllrgd...........gglvvirPL---------------------
00426481   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00483691   1/1  ...glkglagikelaldgglrlirPLlelskeeirayakelglpyiedpsnydldfrrnrirhel-----
00529001   1/1  ----------------------------------------------------------------------
00478481   1/1  ......rferlflallpelgviaplrpllgls--------------------------------------
00488581   1/1  elfgGyptyrpdplarlllldlltlllgvlllrvdrmsmahglevrvPfldhrlvefalslppelkpigg
00502331   1/1  ....rfelyflallpglkiiaPlldlgllell--------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  .rfgylrlallpglelraplldllfPllglskaeirela-------------------------------
00379031   1/1  ----------------------------------------------------------------------
00501281   1/1  llidalnlpvlrPLigldkeeiielareigt---------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00523631   1/1  rlrvegvcarlglkvlaPLwgldqeellrelielgle---------------------------------


                         -         -         +         -         -         -         -:490
query           DEIKNAGLNREIWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDVLGNISTRLVN
00395381   1/1  ----------------------------------------------------------------------
00453911   1/1  glpyrildlilelle-------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00470361   1/1  eelrkaglydkiwqafavllpvrsvGvqgdlrtygyvvvlravlsldamtadlaelplellekisnriln
00473241   1/1  ----------------------------------------------------------------------
00521171   1/1  eaeeildeeglvlglh------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00507391   1/1  edllgvtyelldlilellgv--------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00510381   1/1  eldailevlelgehaglvs.iiglav.lgldrelvlyvldlvlinefkr---------------------
00431811   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00488581   1/1  ltKtllrelarelgll------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EVAEINRVVYDITSKPPGTIEWE-----------------------------------------------
00395381   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00470361   1/1  evpgvnrvvyditskPPatiewe-----------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------