[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50894.1


[Show Plain Result]

## Summary of Sequence Search
   1::256
  67::256  5.6e-47 35.7% 0035026 00350261 1/1   nosyl-L-methionine-dependent methyltran 
   2::66   1.2e-12 33.8% 0035025 00350251 1/1   taxis receptor methyltransferase CheR,  
  45::231  1.6e-11 21.3% 0052084 00520841 1/1   nosyl-L-methionine-dependent methyltran 
   5::231    2e-09 19.0% 0046838 00468381 1/1   nosyl-L-methionine-dependent methyltran 
  53::231  1.4e-08 19.7% 0050762 00507621 1/1   nosyl-L-methionine-dependent methyltran 
  55::231  5.2e-08 17.4% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
  56::231  6.2e-08 20.1% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
  57::231  8.3e-08 20.3% 0046840 00468401 1/1   nosyl-L-methionine-dependent methyltran 
  57::231  1.1e-07 19.1% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
  62::234  2.3e-07 18.7% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
  73::231  2.6e-07 23.4% 0052894 00528941 1/1   nosyl-L-methionine-dependent methyltran 
  55::231  3.1e-07 17.4% 0047656 00476561 1/1   nosyl-L-methionine-dependent methyltran 
  36::231  6.9e-07 18.1% 0052536 00525361 1/1   nosyl-L-methionine-dependent methyltran 
  79::231  8.1e-07 24.4% 0049719 00497191 1/1   nosyl-L-methionine-dependent methyltran 
  40::231  1.2e-06 21.9% 0045060 00450601 1/1   nosyl-L-methionine-dependent methyltran 
  54::231  1.9e-06 22.0% 0053077 00530771 1/1   nosyl-L-methionine-dependent methyltran 
  53::231  2.9e-06 20.2% 0050242 00502421 1/1   nosyl-L-methionine-dependent methyltran 
  46::233  4.4e-06 16.1% 0047211 00472111 1/1   nosyl-L-methionine-dependent methyltran 
  57::233  5.8e-06 18.7% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
  70::256  5.8e-06 21.4% 0052649 00526491 1/1   nosyl-L-methionine-dependent methyltran 
  37::231  7.8e-06 15.5% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
  49::233    1e-05 16.2% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
  69::231  1.6e-05 19.5% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
  42::234  2.6e-05 19.2% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
  83::231    7e-05 24.6% 0052618 00526181 1/1   nosyl-L-methionine-dependent methyltran 
  78::231  8.4e-05 21.0% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
  62::233  0.00015 19.3% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
  79::234   0.0002 17.5% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
 177::231  0.00023 28.3% 0040327 00403271 1/1   nosyl-L-methionine-dependent methyltran 
   1::231  0.00028 18.9% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
  78::231  0.00044 18.3% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
  62::233  0.00045 18.4% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
  37::231  0.00059 21.9% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
 173::231  0.00066 24.6% 0047851 00478511 1/1   nosyl-L-methionine-dependent methyltran 
  79::231  0.00089 19.0% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
   1::256


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDFDRFKEKIYQTFGLDLHSYKENQLKRRLDNLLTRKQYPDYQTFFNYLTSNKNAWHEFLDYLTINVSE
00350261   1/1  ------------------------------------------------------------------nvTs
00350251   1/1  -vlllsllrllelsdedferlrellyertGidlseyKryllerRLarrlralglssfseYldlles----
00520841   1/1  --------------------------------------------elvlsslmdaefWderyde.....ge
00468381   1/1  ----edsllplllllldpllleallslleallegkydllellfgkelfeylagdaelydlfndg......
00507621   1/1  ----------------------------------------------------veehydelaefydkllge
00473861   1/1  ------------------------------------------------------melfdevaeryddfad
00511031   1/1  -------------------------------------------------------kllelldldidllkl
00468401   1/1  --------------------------------------------------------lslapllllllddv
00490741   1/1  --------------------------------------------------------ledllrayllllpe
00491221   1/1  -------------------------------------------------------------mstvplsel
00528941   1/1  ----------------------------------------------------------------------
00476561   1/1  ------------------------------------------------------dlyndlfelfldhsse
00525361   1/1  -----------------------------------lkvdkeeiakfyd.......laaeyydlvyatedg
00497191   1/1  ----------------------------------------------------------------------
00450601   1/1  ---------------------------------------Mssteklsplliehkelveefydslaeryde
00530771   1/1  -----------------------------------------------------keyydeiaery......
00502421   1/1  ----------------------------------------------------dvkdfydelaelyddlld
00472111   1/1  ---------------------------------------------nsdmsddefdpkkyldefyddyagr
00501541   1/1  --------------------------------------------------------dvaeyfddiaavyd
00526491   1/1  ---------------------------------------------------------------------d
00474711   1/1  ------------------------------------ldgwfteilwpglrlllkldellheekskyqiir
00466961   1/1  ------------------------------------------------dlsndlyelyldly..dlyssa
00496711   1/1  --------------------------------------------------------------------ns
00518231   1/1  -----------------------------------------idcallaerlnkalellkdllkklevlrl
00526181   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00469311   1/1  -------------------------------------------------------------erlfdeyae
00499151   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00415801   1/1  mekk.elldwiaelldlgldlykleaellldevlgldragll.lgdrgltleelakflelierrlegepl
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  -------------------------------------------------------------fdsyayfyd
00507451   1/1  ------------------------------------llvlllllllalnkalkllrdllrklglpayrlv
00478511   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FFRDIKMFQTLETKVLPELLQNRGNLKIWSAACSNGCEPYTIAIILEEIANGKRHQIDATDLDNTILQAA
00350261   1/1  ffrdpehfdalaelllpll....pglrvLdlGcGtGeepyslamlllealalagpgarvtatDispeale
00350251   1/1  ----------------------------------------------------------------------
00520841   1/1  tgfdlgepnpllvefleallglpkggrvLdlGCGtGrdalwLa........erGfdVtGvDisetalela
00468381   1/1  .....lrpgserlldlllellpllkpgkrvLDiGcGtG....glalalakalPga..rvtgvDi.pemle
00507621   1/1  lliprpa.teellelllellglkpgkrvLDlGCGtGrlalala......krgp..evtgvDispemlelA
00473861   1/1  glspgqdrllelllellaellk..pgkrvLDiGcGtG....glalalakllgepgarvtgvDispemlel
00511031   1/1  sllklkkinklyknlknlilkntsnvskeeiakfydlvadffdevaayydglfgdllslrpaqeellell
00468401   1/1  lleawlslldallegrldllellyglglfeylaldaevydafldglrpatellldlllellglkpgkprv
00490741   1/1  llllleslenladhldlgnppfelllgeeffeyfakvyelydafndglrpatrlllelllellglkpgkr
00491221   1/1  skklaeeffydlaadfydllldglfpsqrelldlllellglkpgkrvLDlGcGtGg....lalalakr..
00528941   1/1  --ylgdydklrllrsnlaeqllsllalrrglrilDlGcGtG...alllalaevlppdv..rvvgvDisee
00476561   1/1  yalinqllleelvellldlldlkpglkvLDiGcGtGelalalakklpalfpsigakvtgvDiseemiela
00525361   1/1  ylgglflfngadleesaefladlllellgllpgkrvLDvGcGtG.......rltlallarlgaevtgvDl
00497191   1/1  --------llllralllllelvelllelleklldsllkgeipfeyllgedffeyfdddaelydgfndgls
00450601   1/1  lrgvllrpaqrallelllellgllpgkrvLDvGCGtGl....lslalaer..ga..eVtgvDiseemlel
00530771   1/1  .....dpaqrallelllellgllpggrvLDlGCGtGr....lalalarr..ga..rvtgvDlspemlela
00502421   1/1  elsd.......alldlllellglkpgkrvLDiGcGtGglalal............grvtgvDispemlel
00472111   1/1  ffrlr.eilrllldellallgllpggrvLDvGcGtGllalalaral.....ppgarvtgvDlspealela
00501541   1/1  gfaeglreaaeallelllellp..pgkrvLDiGcGtG.......glalalakr.garvtgvDispemlel
00526491   1/1  dlyddglsliqrellelllelldlllkpgkrvLDiGcGtGglalalakll......pgakvtgvDispem
00474711   1/1  iydlgndgrvllldglvlgsrpd..eaqerllllllallplkpgkrvLDiGcGtGglalalakrgpd...
00466961   1/1  ydllgdrpltdalleallellglkpgkrvLDlGcGtG.......glalalakrgakrvtgvDisp.mlel
00496711   1/1  vsglfdsiashydllndlyellldedyfysygyfddyglglrpaqeallelllellglkpgkrvLDiGcG
00518231   1/1  ilregdglpglavdrygdwlvvlllealgeeeleelleallellpelrvnllkisredlleelldeliel
00526181   1/1  ------------lqeitedllellfnallllienlldgaldalleilpellgllflldlllddellrell
00479191   1/1  -------YdlgndlyellldedyfysdayyddpgdllrpaqerllelllellglkpgkrvLDiGcGtGgl
00469311   1/1  fydlanglglrprqeallelllellplkpgkrvLDlGcGtGglalalakl......gpk.rvtgvDisp.
00499151   1/1  --------Llvlgllielltpglrlllkvdelllserskyqeirvyelgddgrvllldgllqgsslderq
00403271   1/1  ----------------------------------------------------------------------
00415801   1/1  eyllglyeflglefgtgpgvfiprpttelllelllellglkpgkrvLDlGcGsGllaialak.l.....g
00502341   1/1  -------al..klelllellglkpgkrvLDiGcGtG.......glalalakrg.arvtgvDispemlela
00528071   1/1  alnllqlrprtealleallellglkpgkrvLDlGcGtGglalalak......rgak.rvtgvDisp.mle
00507451   1/1  lgegdllrglavdrygdwlvvlllselgleelealleallellppidlrvnklkisreelgepvelllge
00478511   1/1  ----------------------------------------------------------------------
00509881   1/1  --------kalldillwliellslglalslkidklleeekskyqiiriydlgnfgyelfldgrllysrld


                         +         -         -         -         -         *         -:210
query           ASGSYGADLVRNISKDRLAKYFTVEQGRYFISNKIKSKVNFKQHNLLADTYPKGYDLIACRNVTIYFTRE
00350261   1/1  kareglyplgllrglplellkryflkllgadgglyrvkpelrdrveflqgdlldlpppldgsfDlifcrn
00350251   1/1  ----------------------------------------------------------------------
00520841   1/1  reraklaglvtrlgeleggklflysgpn..........itfvqgdlfdlpfapdgsfDlvydrgalhalp
00468381   1/1  larer.................................pnvefvvgDaed.plp.sfDlvvsngvlhhlp
00507621   1/1  re..........................rakengl..nvefiqgDaedlpfdgsfDlvvsnpnvlhhlpp
00473861   1/1  arer..........................aaelglsdnvefvvgDaedlplpd.fDlvvsnavlhhlpd
00511031   1/1  lellplkpgkrvLDiGcGtG.......glalalakrlga.rvtgvDispemlelarenaa..........
00468401   1/1  LDiGcGtGglalalakrlPga......rvtgvDi.pemlelarer.........................
00490741   1/1  vLDiGcGtG....glalalakalPga..rvtgvDi.pemlelar..........................
00491221   1/1  ga..rvtgvDispemlelarenaa..........................elglsdaddnvefivgDaed
00528941   1/1  alekarqrl..........................ganpl..niefivgdalqlplpggfDlilsnfvle
00476561   1/1  ke..........................rakelglsdnvnvefivgdaeellleqlepfedekfDliisn
00525361   1/1  seemlevare..........................rlaeagl.prvefvvgdaedlpfpdgsfDlivss
00497191   1/1  gaqelllelllellplkpgkrvLDiGcGtGglalalakalpga......kvtgvDi.pemlelaren...
00450601   1/1  Areraaengldpg.............................adnvefvvgdaedlpellfpdgsfDlvv
00530771   1/1  re..........................raaaagl.dnvefvvgdaedlpfdgsfDlvvsngvlhhlppe
00502421   1/1  arer..................................nvefvvgdaedlpfpdgsfDlvvssavlhhl.
00472111   1/1  re..rlaeaglafdwspllkvvlelegnlelleeleellradrvrfvvgdaedlppllalplpdgsfDav
00501541   1/1  arer..........................aaelgl..nvefvvgDaedlpfpdgsfDlvvsnavlhhlp
00526491   1/1  lelarenakel..........................glpn.vefivgDaedlpellpdgsfDlivsnpP
00474711   1/1  ...arvtgvDispealela..........................renlalnglelglpnvefivgDaed
00466961   1/1  are..........................naaenglpnrvefivgDaedlplpdgsfDlvvsnpsgvlhh
00496711   1/1  tGglalalakal.....g.a.rvtgvDispemlelarena..........................aelg
00518231   1/1  llgerdllgelyenglrflvdpdgfgtglfptqellaelllelld..pgkrvLDlGcGtGglalala.kl
00526181   1/1  dllseidlseidydilgelyeyllgefaglrfklgefytprpvtellvelllpklgdlkglrvLDpgCGs
00479191   1/1  alalakal.....g..arvtgvDispemlelarera..........................aelglpnr
00469311   1/1  mlelarenaa..........................englpnrvefivgDaedlleplpd.fDlvvsnPp
00499151   1/1  rallllllallglkpgkrvLDiGcGtG.......glalalakrpegarvtgvDispealelarenla...
00403271   1/1  ------------------------------------prvefvvgDafd.plp.sfDlivsswvlhhlpde
00415801   1/1  a.akvtgvDispealelAr..........................enaelnglsnrvefivgdaleflpf
00502341   1/1  reraae..........................lgl.pnvefvvgDaedlpfpdgsfDlvvsnavlhhl..
00528071   1/1  laren..........................aaenglpnrvefivgDaedlplpdgsfDlvvsnplpfvl
00507451   1/1  lpeelyvqflglkfkvdpgvffrpgte...llvelllelldlkpgkrvLDlGcGtGglalala.......
00478511   1/1  --------------------------------nglpnrvefivgdaedl..dgsfDlvvsngvlehllle
00509881   1/1  eaqytelllllllldlkpgkrvLDiGcGtGglalalakr......gpaakvtgvDispealelarenlke


                         -         -         -         +         -         -         -:280
query           AQDKVNARFAQSLNPGGYLFIGGSETIFNYAEIGFEKVSPCFYRKK------------------------
00350261   1/1  vliyfddelqerllrrlarlLkpgGlLvlghsesl.glldelfell------------------------
00350251   1/1  ----------------------------------------------------------------------
00520841   1/1  pedrrkylkelarlLkpgGrl-------------------------------------------------
00468381   1/1  dpeleallrelarvLkPGGrl-------------------------------------------------
00507621   1/1  edlekllrelarvLkPGGrlv-------------------------------------------------
00473861   1/1  pdleallrelarvLkpGGrlv-------------------------------------------------
00511031   1/1  ................elgl.-------------------------------------------------
00468401   1/1  ........pnvefvvgDaed.-------------------------------------------------
00490741   1/1  enaaelglspnvefvvgDaed-------------------------------------------------
00491221   1/1  lplpellledgsfDlvvsnfavlh----------------------------------------------
00528941   1/1  hl..edprkllrelarvLkpg-------------------------------------------------
00476561   1/1  nvlhhv..pdleaalkelyrl-------------------------------------------------
00525361   1/1  evlhhlsdedlaaflrelrrv-------------------------------------------------
00497191   1/1  .....................-------------------------------------------------
00450601   1/1  snfgvlhhlPpyfldpedlea-------------------------------------------------
00530771   1/1  dleallaelarvLkpGGrlll-------------------------------------------------
00502421   1/1  .pdpeallrelarvLkPGGrl-------------------------------------------------
00472111   1/1  vssfvlhhvppdlpdleralrel-----------------------------------------------
00501541   1/1  dedleallrelarvLkPGGrlvl-----------------------------------------------
00526491   1/1  ypwpgvlhhlpdellekllkelarvLkpGGrlvlstpnrdyleell------------------------
00474711   1/1  flpfldgsfDlivsdpplhhl-------------------------------------------------
00466961   1/1  lpde.leallrelarvLkPGGrl-----------------------------------------------
00496711   1/1  lpnrvefvvgDaedl..dgsf-------------------------------------------------
00518231   1/1  .....ga.grvtgvDispealela----------------------------------------------
00526181   1/1  Ggllialakrlpnag.gae..-------------------------------------------------
00479191   1/1  vefvvgDaedl..dgsfDlvv-------------------------------------------------
00469311   1/1  ggvlhhlpd..leallrelarvL-----------------------------------------------
00499151   1/1  .......................e----------------------------------------------
00403271   1/1  elvkllkeayraLkpgGrlii-------------------------------------------------
00415801   1/1  pdgkfDlivsNPPygglsell-------------------------------------------------
00502341   1/1  pdpeallrelarvLkPGGrlv-------------------------------------------------
00528071   1/1  hhlp..dleallreaarvLkPGG-----------------------------------------------
00507451   1/1  .rpgakvtgvDispealelar-------------------------------------------------
00478511   1/1  ggldglpdpekalkelarvLk-------------------------------------------------
00509881   1/1  .....................-------------------------------------------------