[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for dred0:ABO50917.1


[Show Plain Result]

## Summary of Sequence Search
   1::337
 117::329  5.1e-66 43.2% 0047987 00479872 2/2                                           
 237::337  1.5e-32 55.4% 0048924 00489242 2/2                                           
   9::101  3.1e-15 41.8% 0047987 00479871 1/2                                           
 110::199  3.3e-07 21.1% 0048924 00489241 1/2                                           
   1::337


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNQYEKLTGEQKAAILLISLGADVSSKLLKQEFTEDEVEKVTAAIAEMDKVPNDIQKQVVEEFIYLIQAR
00479872   2/2  ----------------------------------------------------------------------
00489242   2/2  ----------------------------------------------------------------------
00479871   1/2  --------dpevlanllknegpqkaAilLlaLgpevAaevLkl.Lpeeeveeillriaklgsvspevlee
00489241   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DYLLNGGVNYAKELLEKTYGYDKGSEILERISSTMQSVPFGSLRKTDPRHILSFIREEHPQTIAFVLSYL
00479872   2/2  ----------------------------------------------dpevlanllknegpqkaAilLlaL
00489242   2/2  ----------------------------------------------------------------------
00479871   1/2  vleeleellealaslsllavggveyvadiLn---------------------------------------
00489241   1/2  ---------------------------------------mFtFedllrlddralqlllrevdpdtlalaL


                         +         -         -         -         -         *         -:210
query           KPDQAAVILAELDSQLQSEVARRVAILDRISPDVAKEVEKVLEKKLASVAQHEETVVGGVQCLVNILNRV
00479872   2/2  gpevAaevLklLpeeeveeillriaklgsvspevleevleeleellealaslsllavggveyvadiLnkl
00489242   2/2  ----------------------------------------------------------------------
00479871   1/2  ----------------------------------------------------------------------
00489241   1/2  kgadeelrekilsnlskraaemleeelellgpvrledveeaqkeiveivrelaeeGeiv-----------


                         -         -         -         +         -         -         -:280
query           DRSTEKTIFEDLERADPNLSEEVRRLMFIFEDIVKLHDISIQKVLREVDNKDLALAMKGSNQEVNNRIYK
00479872   2/2  gedkaeellesleeldpelaeeirklmftfedllrlddralqlllrevdldvlalaLkgaseelrekils
00489242   2/2  --------------------------mFtFedllrlddralqlllrevdpdtlalaLkgadeelrekils
00479871   1/2  ----------------------------------------------------------------------
00489241   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NMSKRASEMLKEEIDYMGPVRLKDVEEAQQRIVNVIRRLEEAGEIVISRGGEDAILV-------------
00479872   2/2  nlskraaelleeelealgpvrlseveeaqkeivaivrelaeeGeivllg---------------------
00489242   2/2  nlskraaemleeelellgpvrledveeaqkeiveivrelaeeGeivlalggedelll-------------
00479871   1/2  ----------------------------------------------------------------------
00489241   1/2  ----------------------------------------------------------------------